KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513821
Entry
107513821         CDS       T06036                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04217  Necroptosis
ray04630  JAK-STAT signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04917  Prolactin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107513821
   04630 JAK-STAT signaling pathway
    107513821
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107513821
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107513821
   04659 Th17 cell differentiation
    107513821
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107513821
   04935 Growth hormone synthesis, secretion and action
    107513821
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513821
   05203 Viral carcinogenesis
    107513821
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107513821
   05220 Chronic myeloid leukemia
    107513821
   05223 Non-small cell lung cancer
    107513821
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513821
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107513821
   05161 Hepatitis B
    107513821
   05162 Measles
    107513821
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107513821
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107513821
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 107513821
NCBI-ProteinID: XP_016006349
LinkDB
Position
Unknown
AA seq 793 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLENPQDQAQATQL
LKGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQKLV
REANNGTSPPGILVDAMSQKHLQINQTFEELRLVTQDTENELKNLQHTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETDLQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVGEMLSKVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSALFRNMS
LKRIRRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCDALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLVKAVDGYVKPQIKQVVPEFVTSADSAAGSATYM
DQAPSPVVGPQAHYNMYPQNPDSALDQDGEFDLDETMDVARHMEELLCRPMDGLDPHLSP
PASLFTSTRGSLS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctatatgggcagcacttccccatcgaggttcggcactacttagcgcagtggatcgagagc
cagccttgggatgccattgacctggaaaatccccaggatcaggcccaggccacccagctc
ctgaagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactatgctactcagctccagaacacatatgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaatgaacagaagctggtc
cgagaagccaacaatggtacctctcctcctggaatcctggtcgacgccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacggagaat
gaactgaagaacctgcagcatactcaagagtacttcatcatccagtatcaagagagcttg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggacctccaacagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcattctggatgacgaactgatccagtggaagcgcaggcagcag
ctggccgggaacggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaatcggcagcagatccgcagagctgagcacctctgc
cagcagctgcccatccccggcccagtgggggagatgctgtccaaggtcaacgccaccatc
acagacatcatctccgccctggtgaccagcacattcatcattgagaagcagccccctcag
gtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccgcaggtgaaagccaccatcatcagcgagcagcaggccaag
tccctgctcaagaacgagaacacgcgcaatgagtgcagtggagagatcttgaacaactgc
tgtgtgatggagtatcaccaagccactggcaccctcagcgccctcttcagaaacatgtcg
ctgaagaggatcaggcgtgccgaccgtcggggcgcagagtctgtgacagaggagaagttc
acggtcttgtttgagtctcagttcagcgtaggcagcaatgagcttgtgttccaggtgaag
accttgtcccttcctgtggttgtcatcgttcatggcagccaggaccacaatgccaccgcc
actgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgatgcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaaactgttcaacagc
agcagcagccacctggaggactacaacagcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcaatggttcgatggggtcatggaggtg
ctgaagaagcatcacaagccccattggaatgacggggccatcctaggttttgtgaataag
caacaggcccacgacctactcatcaacaagcccgatgggaccttcttattgcgctttagc
gactcggaaatcgggggcattaccattgcctggaagtttgactctcctgatcgcaacctg
tggaacctgaagccattcaccacgcgggacttctccatccggtccctggctgaccgcctg
ggggacctgagctatctcatctatgtgtttcctgaccggcccaaggacgaggttttctcc
aagtactacactcctgtgctggttaaagcagtggacggatacgtgaagccacagatcaag
caagtggtccccgagtttgtgacatctgcagactctgcagcgggcagtgccacctacatg
gaccaggccccctctccagtcgtgggcccccaggctcattataacatgtacccgcagaat
cctgactccgcacttgaccaggacggagaattcgacctggatgagaccatggatgtagcc
cgacacatggaggaactcctatgccgcccgatggacggtctggacccccacctgtccccg
ccggccagtctttttacctctaccagaggctcactctcttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513822
Entry
107513822         CDS       T06036                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04062  Chemokine signaling pathway
ray04217  Necroptosis
ray04630  JAK-STAT signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04917  Prolactin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107513822 (STAT5B)
   04630 JAK-STAT signaling pathway
    107513822 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107513822 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107513822 (STAT5B)
   04659 Th17 cell differentiation
    107513822 (STAT5B)
   04062 Chemokine signaling pathway
    107513822 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107513822 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    107513822 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513822 (STAT5B)
   05203 Viral carcinogenesis
    107513822 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107513822 (STAT5B)
   05220 Chronic myeloid leukemia
    107513822 (STAT5B)
   05223 Non-small cell lung cancer
    107513822 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513822 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107513822 (STAT5B)
   05161 Hepatitis B
    107513822 (STAT5B)
   05162 Measles
    107513822 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107513822 (STAT5B)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107513822 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 107513822
NCBI-ProteinID: XP_016006352
LinkDB
Position
Unknown
AA seq 788 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQETIKATQL
LDGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPSGSLADTMSQKHLQINQTFEELRMVTQDTESELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQ
LLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEH
LCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGG
KLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRN
MSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNA
TATVLWDNAFAEPGRVPFAVPDKVLWPQLCDALNMKFKAEVQSNRGLTKENLVFLAQKLF
NSGSGHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFV
NKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLAD
RLGDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVTSADSV
GGSATYMDQAPSPVVGPQAHYNMYPQNPDPVLDTDGDFDLDDTMDVARRVEELLGRPMDT
QWIPHAQS
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggctgtgtggatccaagcccagcagctgcagggagatgcccttcaccagatgcaagca
ttgtatggccagcatttccccattgaggtgcgccattatttatcccagtggattgaaagc
caagcatgggactcaatagatcttgataatccacaggagaccattaaggccacccagctc
ttggatggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaatggtacctctccatctggaagtcttgctgacaccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgaatggtcacgcaggacacagagagt
gaactgaagaagctgcagcagactcaagagtacttcatcatccagtatcaagagagcctg
aggatccaggctcagttcgcccagctggcccagctgaacccccaggagcgtctgagccgg
gagacggagacggccctgcagcagaagcaggtgtccctggaggcctggctgcagcgcgag
gcccagacgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcag
ctgctgcggaagcagcagaccatcattctggatgacgaactgatccagtggaagcgcagg
cagcagctggccgggaacggagggccccccgagggcagcctggacgtgctgcagtcctgg
tgtgagaagctggccgagatcatctggcagaaccggcagcagatccgcagagctgagcac
ctctgccagcagctgcccatccccggcccagtagaggagatgctggctgaggtcaacgcc
accatcacagacatcatctcagccctggtgaccagcacattcatcattgagaagcagccc
cctcaggtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggcggg
aagctgaacgtgcacatgaaccccccgcaggtgaaagccaccatcatcagcgagcagcag
gccaagtccctgctcaagaacgagaacacgcgcaatgattacagtggagagatcttgaac
aactgctgtgtgatggagtatcaccaagccactggcaccctcagcgcccacttcagaaac
atgtccctgaaacgaattaagaggtctgaccgtcgtggagcagagtcggtaacagaagaa
aaatttacaatcctgtttgagtcacagttcagtgttggtggaaatgagctggtttttcaa
gtcaagaccctgtccctcccggtggtggtgattgttcacggcagccaggacaacaatgcg
acagccaccgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtg
cctgacaaagtgctgtggccacagctgtgtgatgcgctcaacatgaaattcaaggccgaa
gtgcagagcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaaactgttc
aacagcggcagcggccacctggaggactacaacagcatgtctgtgtcctggtcccagttc
aacagggagaatttaccaggacggaattacactttctggcagtggtttgatggcgtgatg
gaagtattaaaaaaacatctcaagcctcattggaatgatggggctattttgggttttgtg
aataagcaacaggcccacgacctactcattaacaagcccgatgggaccttcctgctgaga
ttcagcgactctgaaattggcggcatcaccattgcttggaagtttgattctcaggaaaga
atgttttggaatctgatgcctttcaccaccagagacttctctatccgttccctggcggac
cgcttgggggacttgaattaccttatctacgtgttccctgatcggccaaaagatgaagtg
tactccaagtattacacaccagttccatgcgagcctgccactgctaaagcagtggacgga
tacgtgaagccacagatcaagcaagtggtccccgagtttgtgacatctgcagactctgta
gggggcagtgccacctacatggaccaggccccctctccagtcgtgggcccccaggctcat
tataacatgtacccgcagaatcctgaccccgtccttgacactgatggggacttcgatctg
gacgacacgatggacgtggcgcgccgtgtggaggaactcttaggccgacctatggacact
cagtggatcccgcacgcacagtcgtga

DBGET integrated database retrieval system