KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513944
Entry
107513944         CDS       T06036                                 

Gene name
SGCB
Definition
(RefSeq) LOW QUALITY PROTEIN: beta-sarcoglycan
  KO
K12566  beta-sarcoglycan
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107513944 (SGCB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107513944 (SGCB)
   05414 Dilated cardiomyopathy
    107513944 (SGCB)
   05416 Viral myocarditis
    107513944 (SGCB)
SSDB
Motif
Pfam: Sarcoglycan_1
Other DBs
NCBI-GeneID: 107513944
NCBI-ProteinID: XP_016006645
LinkDB
Position
Unknown
AA seq 320 aa
MAAAAAAAAAAEQQSSNGPVKKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLR
GRKGNLAICVIILLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGV
IHPLYKSTVGGRRNENLVIIGNNQPIVFQQGTTKLSVEKNKTSITSDIGMQFFDPRTQNI
LFSTDYETHEFHLPSGVNTLNVQKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKT
IEFHMGGNMELKAENSIILNGTVMVSTTRLPSSSSGDQFGTGDWVRYKLCMCADGTLFKV
QVTGQNMGCQITDNPCGNTH
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcggctgcggcggcggcggcggcggcggccgagcagcaaagttctaatggtcctgta
aagaagtccatgcgtgagaaggctgttgagagaagaaatgtcaataaagagcacaatagc
aactttaaagccggatatattccaattgatgaagatcgcctccataaaacgggcttgaga
gggagaaagggcaatttagccatctgcgtgattatcctcttgtttatcctggctgtcatc
aacttaattataacacttgttatctgggctgtgattcgcattggaccaaatggctgtgac
agcatggagtttcacgaaagtggtctgcttcggtttaaacaagtatctgacatgggagtt
atacatccgctttataagagcacagtaggaggaaggcgaaatgaaaatttggtcatcatt
ggcaacaaccagcctattgtttttcagcaagggacaacaaagctcagtgtagaaaagaac
aaaacttctattacaagtgatattggtatgcagtttttcgacccaaggactcaaaatatc
ctgttcagcacagactatgaaactcatgagtttcatttaccaagtggagtgaatactttg
aatgttcaaaaagcctctactgaaaggattaccagcaatgctactagtgatttaaatata
aaagttgatgggcgtgctatagtgcgtggaaatgaaggagtgttcattatgggcaaaacc
attgaatttcacatgggtggtaatatggagttaaaagcagaaaacagcatcatcctaaat
ggaactgtgatggttagcacaactcgcctgcctagttcctccagtggagaccagtttggt
actggcgactgggtgcgctacaagctttgcatgtgtgctgacggaactctcttcaaagta
caagtaacaggccagaacatgggctgccaaatcacagacaacccctgtggaaacactcat
tag

DBGET integrated database retrieval system