KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514061
Entry
107514061         CDS       T06036                                 

Gene name
SCTR
Definition
(RefSeq) secretin receptor isoform X1
  KO
K04588  secretin receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04972  Pancreatic secretion
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107514061 (SCTR)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    107514061 (SCTR)
   04976 Bile secretion
    107514061 (SCTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107514061 (SCTR)
G protein-coupled receptors [BR:ray04030]
 Secretin receptor family
  Gut peptide
   Secretin
    107514061 (SCTR)
SSDB
Motif
Pfam: 7tm_2 HRM Polysacc_synt_C Insulin_TMD
Other DBs
NCBI-GeneID: 107514061
NCBI-ProteinID: XP_016006894
LinkDB
Position
Unknown
AA seq 468 aa
MRLCSPPPCLRRLLVLLLLLLLLTRAAHTVGAFPRLCDVLQVLWEEQDQCLQELSKEKTG
DLSMEQPSPGCEGLWDNMSCWPSSALGQTVEVECPRFFQILTGRNGSMFRNCTQNGWSET
FPRPDVACGVNVNNSSNEINEKRHKYLLKLKVMYTVGYSSSLVMLLVALSILCAFRPGPF
GPAFSPSRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVHCNTHRVGCKLVMVF
FQYCIMANYAWLLVEGLYLHTLLVISFFSERKCLQRCIALGWGSPAIFAVSWAITKHFME
DVGCWDINANLSVWWVIRGPVILSILINFILFINILRILMRKLRTQETRGNEVNHYKRLA
KSTLLLIPLFGVHYIVFALSPEDAMEIRLFFELALGSFQGLLVAVLYCFLNREVQLEVQK
KWRQWHLHEIPLRPVALSSSFNNGTSSLTNSTKGSLSGPSQCTCRTST
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcgcctctgctcgccacctccgtgcctgcggcggctgctggtgctgctgctgttgctg
ctgctgctcacccgcgccgcgcacacggtcggagccttccctcgactgtgcgatgtgcta
caggtgctgtgggaggaacaggaccagtgcctgcaggaactctccaaagagaagacagga
gacttgagcatggagcagccatccccaggctgcgaggggctctgggacaacatgagctgc
tggccctcatctgctctgggacagactgtggaagtggagtgcccacgattcttccagatc
ctcacaggcagaaacggttccatgtttcgaaactgcacacagaatggctggtcagaaacc
ttccccaggcctgatgtggcctgtggggttaatgtgaacaactcgtccaacgagatcaac
gagaagcggcacaagtacctgctgaagctgaaggtcatgtacactgtgggctatagctcc
tccctggtgatgctcctggttgccctcagcatcctctgtgctttccgcccaggccccttt
ggccctgctttctctccctccaggaggctgcactgcaccagaaattatatccacatgcac
ctgtttgtgtccttcatcctgcgtgccctatccaacttcatcaaggatgctgtgctcttc
tcctcagatgatgtccactgcaatacccacagggtgggctgtaagctggtcatggtcttc
ttccagtactgcatcatggccaactacgcctggctgctggtggaaggcctctaccttcac
acactccttgtcatctccttcttctcagaaaggaagtgccttcagagatgtattgccctc
ggatggggttctccagccatctttgctgtttcatgggctatcaccaaacactttatggaa
gatgttgggtgctgggacatcaatgccaatttatctgtctggtgggtcattcgagggcct
gtgatcctctctatcctgattaatttcatcctttttataaacattctaagaattctgatg
agaaaacttagaacccaagaaacaagaggaaatgaagtgaatcattataagcgtctagcc
aagtccactctcctgctgatccccctcttcggagtccactatatcgtctttgccctctcc
ccagaagatgccatggagattcggctgttttttgaattggcccttggctcattccagggc
ctgctggtggcagtcctctactgctttctcaacagagaggtgcagctggaggtacagaag
aagtggcggcaatggcacctccatgagatcccactgcgtcctgtggccctcagctcctcc
tttaacaatggcaccagcagccttacaaacagcaccaagggcagcctctcagggcctagc
cagtgcacctgcaggaccagcacctga

DBGET integrated database retrieval system