KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514148
Entry
107514148         CDS       T06036                                 

Gene name
KIF7
Definition
(RefSeq) LOW QUALITY PROTEIN: kinesin-like protein KIF7
  KO
K18806  kinesin family member 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04340  Hedgehog signaling pathway
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107514148 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514148 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107514148 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107514148 (KIF7)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     107514148 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 107514148
NCBI-ProteinID: XP_016007054
LinkDB
Position
Unknown
AA seq 1341 aa
MVLEAQRPPGAEEAPVRVALRVRPLLPKELLHGHQSCLRVEPGQGRVTLGRDRRFGFPVV
LDEDAGQEAVYQACVQPLLEAFFQGFNATVFAYGQTGSGKTYTMGEASVASLREDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEDFRDLLEAGTAGRDIQLREDEHGNVVLCG
AKEVDVEGLDEVLSVLEMGNAARHTGATHLNRLSSRSHTVFTVTLEQRGRTPSRPPRQAP
GQLLVSKFHFVDLAGSERVLKTGSTGERLRESIQINSSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERAPEEAAGARGPPRHRSETRIIHRGRAPGPPPPPPPRAAARLGAECARYRRXTDAAYS
LLRELQAQPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIDSASAAEEQAAQAPGGR
KEDEGALLALQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMAELRLRLELVR
PGWGAPGLLQGLPPGSFVPRPHTAPLGGVHSHVLGMVPPTCLPGDEVGPENGVEQVTNGR
EAGVKLLEETDRLDGGSSAASEDEEEDGEQPPPQRTLHLRRNGISKGSRRPEAGPGSPRS
RKDSELRLEELAAAILEPRAVHGSKAQARPHQAPAASEWRLAQAQQKIRELAINIRMKEE
LIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELSEGQRQLRELERREPQDAGERSR
LQEFRKRVAAAQSQVQVLKEKKQATERLVSLSAQSEKRLQELERNVQLMRQQQGQLQRRL
REETEQKRRLEAEMSKRQHRVKELELKHEQQQKVLRIKTEEIAAFQRKRRSGSSGSVLSL
EQQQKIEEQKKWLDQEMEKALQQRRALEELGAELRKREAILAKKEALVQERTGLESKRLR
SSQALTEDIVRVSSRLEHLEKELSEKSGQLRQGSAQSQQQIRGEIDALRQEKDLLLKQRL
EIDGKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQCEM
NLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEVAL
ERQRLEMDRQLTMQQKEHEQNMQLLLQQNRDHLGEGLADSKRQYETRIQALEKELGRHVC
LNQELKQKLSGVDAAGQSRGGEKRTLCLENRPPPGNEGEPHPASEGLWQPPVAESALRAR
EDVRDLVRAPLPLTWKRSSLCGEEQGSPEERRPWEAAEPLLGRALPVGEGTLPWNLGPLV
RPRRELRRASPGMIDVRRNPL
NT seq 4026 nt   +upstreamnt  +downstreamnt
atggtgctggaggcccagaggcctccaggggccgaggaggcccctgtgagggtggccctg
cgagtccggccgctgctgcccaaggagctgctgcacgggcaccagagctgcctgagggtg
gagccagggcagggccgtgtcaccctgggccgggaccgccgcttcggcttccccgtggtg
ctggacgaggacgccgggcaggaggccgtgtaccaggcctgcgtgcagcccctcctggag
gctttcttccagggcttcaacgctacggtcttcgcctatggccagacaggctccgggaag
acgtataccatgggggaggccagtgtggcctccctccgcgaggacgagcagggcatcatc
ccgcgggccatggccgaggccttcaagctgatcgatgagaacgacctgctcgactgcctg
gtgcacgtgtcctacctggaggtgtacaaggaggacttccgagacctgctcgaggcgggc
accgccggccgagacatccagcttcgggaagacgagcacgggaatgttgtgctgtgtggg
gcgaaggaggtggacgtggagggcctggacgaggtgctgagcgtcctggagatgggcaac
gcggcgcggcacacgggagccacgcacctcaaccgcctgtccagccgctcgcacacggtt
ttcaccgtaaccctggagcagcggggacgcacccccagccgccctccgcgccaggccccg
ggccagctgctcgtgtccaagttccacttcgtggacctggccggctctgagcgagtgctc
aagacgggcagcaccggcgagcgcctcagggagagcatccagatcaacagcagcctcctg
gctctgggcaacgtcatcagtgccctgggcgacccccagcgccgcggcagccacatcccc
taccgagactccaagatcacccgcatcctaaaagactcgctgggcgggaatgccaagacg
gtgatgatcgcttgcgtcagcccgtcctcttcggacttcgacgagaccctcaacaccctc
aactacgccagccgcgcccagaacatccgcaaccgtgccaccgtcaactggcggccagag
gccgagcgggcgccggaggaggcggcgggcgcgcggggtcccccgcggcaccgctcggag
acgcgcatcatccaccgcggccgcgcgcccggcccgccgccgccgccccccccccgggcc
gccgcccgcctgggcgccgagtgcgcgcgctaccggcgcngcaccgacgccgcctacagc
ctgctgcgcgagctgcaggcccagcccggcctgcccggggccgccgcccgcaaggtgcgc
gactggctgtgcgccgtggagggcgagcgcagcgccctgagctccgcctccgggcccgac
agcggcatcgacagcgcctccgccgccgaggagcaggccgcgcaggcgcccggcggcaga
aaggaagatgagggggcactgctggccctgcagagccaggtggcccgcctggaggaagag
aaccgagactttctggccgcactggaggacgccatggagcagtacaagctgcagagcgac
cgtctgcgtgagcagcaggaggagatggcggagctacggctgcggctagagctggtgcgg
cctggctggggggccccagggctcctgcagggcctgcctcctgggtcctttgtgccccgg
cctcacacagcccccctggggggcgtccacagccatgtgctaggcatggtgccccctacc
tgccttcctggagatgaagttggccccgagaacggggtagagcaggtgacgaatggcagg
gaggcaggagtcaagttgctggaggagacagacagactggatgggggctcttcagctgca
tcggaggatgaggaagaagacggggagcaaccaccaccccagcggaccctgcacctgcgc
agaaacgggatcagcaaggggagccggaggccggaggccggcccagggagtccccgcagc
aggaaggattcggagctccgccttgaggagctggctgcagctatcctggagcccagagcg
gtgcatgggagcaaggcccaggctcggccccaccaggcccccgctgcttccgagtggcgg
ctggcccaggcccagcagaagatccgggagctggccatcaatatccgcatgaaggaggaa
ctcattggcgagctagtccgcacagggaaggcggcccaggccctgaaccgccagcacagc
cagcgcatccgggagctggagcaggaggccgagcgcgtgcgggccgagctgagtgagggc
cagcggcagctgcgcgagctggagcgcagggagccccaggatgctggtgagcggtcccgg
ctccaggagttccgcaagagggtcgccgcggcccagagccaggtgcaggtgctgaaggag
aagaagcaggcgacggaacggctggtgtcgctgtcggcccagagcgagaagcggctgcag
gagctggagaggaacgtgcagctcatgcgccagcagcaggggcagctgcagcggcggctc
cgggaggagacggagcagaagcggcgcctggaggcggagatgagcaagcggcagcaccgc
gtcaaggagctggagctgaagcacgagcagcagcagaaggtcctgcggatcaagacggag
gagatcgcggccttccagaggaagcggcgcagcggcagcagcggctcggtgctcagcctg
gagcagcagcagaagatcgaggagcagaagaagtggctggaccaggagatggagaaggcc
ctgcagcagcggcgggcactggaggagctgggcgcagagctgcgcaagcgggaggccatc
ctggccaagaaggaggccctggtgcaggagaggacggggctggagagcaagcgcctgcgg
tccagccaggctctcactgaagacattgtgcgggtgtccagccggctggagcacctggag
aaggagctatcggagaagagcgggcagctgcggcagggcagcgcccagagccagcagcag
atccgtggggagatcgacgccctgcgccaggagaaggacttgctgctgaagcagcgcctg
gagatcgacggcaagctgcggcagggcagcctgctgtcacccgaggaggaacggaccctg
ttccagctggacgaggccatcgaggccctggacgctgccattgagtacaagaatgaggcc
atcacatgccgccagcgggtgctgcgggcctcggcctccttgctgtcccagtgcgagatg
aacctcatggccaagctcagctacctctcgtcctcagagaccagagccctcctctgcaag
tacttcgacaaggtggtgacgctgcgggaggagcagcaccagcagcagatcgccttctcg
gagttggagatgcagctggaggagcagcagcggctggtgtactggctggaggtggctctg
gagcggcagcgcctggagatggaccggcagctgaccatgcagcagaaggagcacgagcag
aacatgcagctcctcctgcagcagaatcgggaccaccttggcgaagggttagcggacagc
aagaggcagtatgagaccaggattcaagctctggagaaggagctgggccgccacgtgtgt
ctgaaccaggaactgaagcagaagctcagtggggtggacgccgcaggccagagccggggt
ggggagaagaggaccctgtgcctggagaacaggccaccccctggaaatgaaggtgagccc
cacccagcatctgagggtctctggcagccccccgtagctgagagtgccctccgtgcccgg
gaggacgttcgggacctggtccgggccccactcccactgacgtggaaacgctccagcctg
tgcggtgaggagcagggctccccggaggaacggcggccatgggaggcagcagagcctctc
ttggggcgagcacttcctgtgggggaggggaccctgccctggaacctggggcccctggtc
aggccccggcgggagctgcgcagggccagcccagggatgatcgacgtcaggaggaacccc
ttgtag

DBGET integrated database retrieval system