KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514154
Entry
107514154         CDS       T06036                                 

Gene name
PLIN1
Definition
(RefSeq) perilipin-1
  KO
K08768  perilipin-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03320  PPAR signaling pathway
ray04371  Apelin signaling pathway
ray04714  Thermogenesis
ray04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107514154 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107514154 (PLIN1)
   03320 PPAR signaling pathway
    107514154 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107514154 (PLIN1)
SSDB
Motif
Pfam: Perilipin DUF4660 TfoX_C
Other DBs
NCBI-GeneID: 107514154
NCBI-ProteinID: XP_016007072
LinkDB
Position
Unknown
AA seq 515 aa
MAVNKGPALLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEK
GVQGASSLAAWGMEPVVRRLSTQFIAANDLACRGLDHLEEKIPALQYPPEKIASELKDTI
SSRLRSARNSISVPIASTSDKVLGAALAGCELAWGAAKDTADYAANTRAGRLASGGADLA
LGGVEKVVEFLLPPAKESSGNAPGRPRTQKSPKTKPSLVNRVGALANTVSQHTFQTTVRV
LKQGHALAMWIPGVAPLSSLAQWGASAAMQVVSRRQSEVRVPWLHNLAAAQDEDHDEQTD
TEGEETEQEDESETEEQQLSEVAALPSPQGLLGSVAHSLQKALQGAVSAVTWAPAAVLGT
AGRVLRLTPARAAPHTSSAKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFR
DIEEVVRQEAERRGSGLLPAGPEPTPRPAQHRGSLRSTRGSSLEDRGDQPAAPRPAFPAS
PREKPARRVSDSFFRPSVMEPILGRAQYSQLRKKS
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcggtcaacaagggcccggccttgctggacggagacctccctgagcaggagaacgtg
ctgcagcgggtcctgcagctgccggtggtgagcggtacctgcgagtgcttccagaagacc
tacaccagcaccaaggaggcccaccccctggtggcctcggtgtgcaatgcctacgagaag
ggcgtgcagggcgccagcagcctggcagcctggggcatggagccggtggtccgcaggctg
tccacccagttcatagctgccaacgacctggcctgccggggcctggaccacctggaggaa
aagatcccagccctccagtaccctcctgaaaagatcgcctctgagctgaaggacaccatc
tccagccgccttcgcagtgccaggaacagcatcagtgtgcccatcgccagcacttcggac
aaggtcctgggggccgctctggccggctgtgagctcgcctggggggcagccaaagacacc
gccgactatgctgccaacacccgagctggccggctggcctctggaggagccgacttggcg
ctgggcggtgtggagaaggtggtcgagttcctcctccccccagccaaggagtcatcaggc
aatgctccaggacgcccacggacccagaagtctcctaagaccaagccgagcctcgtgaac
agggttggggcgctggccaacaccgtctctcaacacaccttccagaccacagtccgggtg
ctgaagcagggccacgccctggccatgtggatccccggtgtggctcccctgagcagcctg
gcccagtggggcgcgtcagcggccatgcaggtggtgtcccgacggcagagcgaggtgcgg
gtgccctggctgcacaacctcgccgctgcccaggacgaggaccacgacgagcagacggac
acagagggggaggagaccgagcaggaggacgagtcagagactgaggagcagcagctcagt
gaggtggcagccctgcccagcccacagggcctcctgggcagtgtggcacactccctgcag
aaggccctccagggcgccgtgtcggctgtgacgtgggcacctgcggccgtgctgggcacg
gcagggagggtgctgcgcctcacaccagcccgcgccgcgcctcacaccagctcggccaag
gggagggccatgtcgctgtcagacgccctgaagggcgtgacagacaacgtggtggacaca
gtggtgcactacgtgccgctccccaggctgtcactgatggagcctgagagcgagttccgg
gacatcgaggaggtcgtgcgccaggaggcggagcgcagggggtctgggctgctgcccgct
ggccctgagcccacaccacgacccgcacagcaccgaggcagcctgcgcagcacgcgaggc
tcgagcctggaggaccgaggggaccagcctgctgcgccgcgcccggccttcccggcctcg
ccccgcgagaagccagcgcgcagggtcagcgacagtttcttccggcccagcgtcatggag
cccatcctgggccgagcgcagtacagccagctgcgcaagaagagctga

DBGET integrated database retrieval system