KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514259
Entry
107514259         CDS       T06036                                 

Gene name
AQP2
Definition
(RefSeq) aquaporin-2
  KO
K09865  aquaporin-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107514259 (AQP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107514259 (AQP2)
   04147 Exosome [BR:ray04147]
    107514259 (AQP2)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107514259 (AQP2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107514259 (AQP2)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107514259
NCBI-ProteinID: XP_016007292
LinkDB
Position
Unknown
AA seq 271 aa
MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQNMPSVLQIAVAFGLAIGTLVQALA
HISGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPPNVRGNLAVNA
LGNNTTAGQGVTVELFLTLQLVLCIFASTDERRGDSLGTPALSIGFSVTMGHLLGIYYTG
CSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL
EPDTDWEEREVRRRQSVELHSPQSLPRGSKA
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtgggaactccggtccatagccttctccagggctgtgtttgcagagttcctggccaca
ctcctctttgtcttcttcggcctgggctcagccctcaactggccacagaacatgccctct
gtgttgcagattgccgtagcctttggcttggctatcggcacccttgtgcaggctctggca
cacatcagcggggcccacatcaaccctgccgtgactgtggcctgcctggtgggctgccat
gtgtcctttcttcgagctgccttctacgtggctgcccagctgctgggggctgtggcaggc
gctgccctgctccatgagatcacacccccaaacgtccgaggaaacctggctgtcaatgct
ctcggcaacaacacgacagctggccaaggagtcactgtggagctattcctgaccttgcag
ctggtgctctgcatcttcgcctccactgatgagcgccgtggagacagcctgggcaccccc
gccctctccattggcttctctgtgaccatgggccacctccttgggatctactacactggc
tgctctatgaatcctgcccgatccctggctccagccgttgtcaccggcaaatttgatgac
cactgggtcttctggatcggacccctggtcggagccatcttgggctccctcctctacaac
tacgtcctgttcccgcccgccaagagcctgtcggagcgcctggccgtgctgaaggggctg
gagcccgacaccgactgggaggagcgcgaggtgcggcggcggcagtcggtggagctgcac
tcgccgcagagcctcccgcggggcagcaaggcctga

DBGET integrated database retrieval system