KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514260
Entry
107514260         CDS       T06036                                 

Gene name
AQP5
Definition
(RefSeq) aquaporin-5
  KO
K09867  aquaporin-5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107514260 (AQP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107514260 (AQP5)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107514260 (AQP5)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107514260
NCBI-ProteinID: XP_016007293
LinkDB
Position
Unknown
AA seq 265 aa
MKKEVCSVAFIKAVFTEFLATLIFVFFGLGSALKWPSALPSILQISLAFGLAIGTLAQAL
GPVSGGHINPAITLALLVGNQISLLRATFYVVAQLLGAIAGAGILYGLAPTNARGNLAVN
ALNNNTTPGQAVVVELILTFQLALCVFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMKRFSPAHWVFWVGPIVGAALAAILYFYLLFPNSLSLSERVAVVK
GTYEPEEDWEEQREERKKTMELTAR
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaagaaggaggtgtgctccgtggccttcatcaaggccgttttcaccgagttcctggcc
accctcatcttcgtcttcttcggcctcggatcggccctcaagtggccgtcggcgctgcct
tccatcctgcagatctcgctggcttttggcctggccataggaaccctggcccaggccctg
gggcctgtgagtggcggccacatcaaccccgccatcacactggccctcttagtgggcaac
cagatctccctgctccgggctaccttctacgtggtggcccagctgctcggagctattgcg
ggagcaggcatcctctatgggctggcaccaaccaatgcccggggcaatctggctgtcaat
gcgctcaacaacaatacaacaccgggccaggccgtcgtggtagagctgattctgaccttc
cagctggcgctctgtgtcttctcctccaccgactcccgccgcaccagccctgtgggctcc
ccagccctatccattggcctgtcggtcacactgggccatctcgtggggatctacttcact
ggctgctctatgaacccggcccgctcttttggccccgcagtggtcatgaagcgtttcagc
cctgcacactgggtattctgggtggggcccatcgtgggggctgctttggctgccattctc
tacttctacctgctcttccccaactccctgagcctaagtgagcgtgtggctgtcgtcaag
ggcacatacgagcctgaagaggactgggaggagcagcgggaggagcggaagaaaaccatg
gagctgactgcccgctga

DBGET integrated database retrieval system