KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514262
Entry
107514262         CDS       T06036                                 

Gene name
AQP6
Definition
(RefSeq) aquaporin-6 isoform X1
  KO
K09868  aquaporin-6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107514262 (AQP6)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107514262 (AQP6)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107514262
NCBI-ProteinID: XP_016007300
LinkDB
Position
Unknown
AA seq 303 aa
MVEIGGCSLVGMLGCQLWVAIGKALFAEFLATGLYVFFGVGSALHWSSALPSVLQVAITF
NLATATAVQVTWKTSGAHANPAVTLAFLVGSQISLPRAVAYVAAQLAGAIVGAALLYEVT
PGDVRETLGVNEVRSNVSTGQAVVVELVLTLQLVLCVFASMDSRQASGSPAAMIGISVAL
GHLIGIYFTGCSMNPARSFGPAVIVGKFTVHWVRPSTGSHGKGRGPKWGHRDYGGFHQQW
GHRDLGRQVLLPQNILTPDGVFSKLRRPGRVSWLCTKFLYNFNSPGCLVGWQEMGQGKSR
SLG
NT seq 912 nt   +upstreamnt  +downstreamnt
atggtggagataggagggtgcagcttggttgggatgctggggtgccagctctgggtggcc
atcggcaaggcgctgtttgccgagttcctggccacggggctgtatgtgttctttggtgtg
ggttcggctctgcactggtcttcggcgcttccctctgtgctgcaggtcgccattaccttc
aatctggccacagccacggctgtgcaggtcacctggaagaccagtggggctcatgccaac
cccgccgtgacactggccttccttgtgggctcccaaatctcactgccccgggctgtggcc
tacgtggctgcccagctggcaggggccattgtgggggctgctctgctttatgaggtcaca
ccaggggacgtccgagaaacccttggagttaatgaggtccggagcaacgtgtcgactggc
caggcagtggtggtggagctggttctgaccctgcagctggtgctctgtgtctttgcttcc
atggacagccgtcaggcatcaggctccccagcagccatgattgggatctctgtggcattg
ggccacctcattgggatctacttcactggctgttctatgaatccagcccgctccttcggt
cctgccgtcatcgttgggaagtttacagtccactgggtgagaccctcgactggcagccat
gggaaggggagagggcccaagtgggggcatagagactacggtggctttcaccagcagtgg
ggccatagagacttagggagacaagtcctcctgccgcagaacatcttgaccccagatgga
gttttctctaagctcagaagaccagggagagtatcctggctctgtactaaatttctttac
aacttcaatagtccagggtgtctggtgggctggcaagaaatgggccagggcaagagccgc
agccttggctaa

DBGET integrated database retrieval system