KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514416
Entry
107514416         CDS       T06036                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04210  Apoptosis
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04926  Relaxin signaling pathway
ray04931  Insulin resistance
ray05132  Salmonella infection
ray05134  Legionellosis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107514416 (NFKBIA)
   04668 TNF signaling pathway
    107514416 (NFKBIA)
   04024 cAMP signaling pathway
    107514416 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107514416 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107514416 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    107514416 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    107514416 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    107514416 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    107514416 (NFKBIA)
   04660 T cell receptor signaling pathway
    107514416 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    107514416 (NFKBIA)
   04659 Th17 cell differentiation
    107514416 (NFKBIA)
   04657 IL-17 signaling pathway
    107514416 (NFKBIA)
   04662 B cell receptor signaling pathway
    107514416 (NFKBIA)
   04062 Chemokine signaling pathway
    107514416 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107514416 (NFKBIA)
   04926 Relaxin signaling pathway
    107514416 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107514416 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107514416 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514416 (NFKBIA)
   05203 Viral carcinogenesis
    107514416 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107514416 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107514416 (NFKBIA)
   05215 Prostate cancer
    107514416 (NFKBIA)
   05222 Small cell lung cancer
    107514416 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107514416 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107514416 (NFKBIA)
   05135 Yersinia infection
    107514416 (NFKBIA)
   05134 Legionellosis
    107514416 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107514416 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    107514416 (NFKBIA)
   05161 Hepatitis B
    107514416 (NFKBIA)
   05160 Hepatitis C
    107514416 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    107514416 (NFKBIA)
   05164 Influenza A
    107514416 (NFKBIA)
   05162 Measles
    107514416 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    107514416 (NFKBIA)
   05163 Human cytomegalovirus infection
    107514416 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107514416 (NFKBIA)
   05169 Epstein-Barr virus infection
    107514416 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107514416 (NFKBIA)
   05140 Leishmaniasis
    107514416 (NFKBIA)
   05142 Chagas disease
    107514416 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107514416 (NFKBIA)
   04131 Membrane trafficking [BR:ray04131]
    107514416 (NFKBIA)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    107514416 (NFKBIA)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107514416 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 107514416
NCBI-ProteinID: XP_016007575
LinkDB
Position
Unknown
AA seq 314 aa
MFQPAEHAQDWAMEGPRDALKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCGTQHLHSVLQAAN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQLLPESEDEESYDTESEFTEDEL
PYDDCVLGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagcccgccgagcacgcccaggactgggctatggagggcccccgggacgcgctc
aagaaggagcggctggtggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg
cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcatccatgaagagaaggcactgactatggaagtggtccgccaagtgaagggagac
ctggcctttcttaacttccagaacaacctgcagcagactccactccacttggctgtgatt
accaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggttgcctggccagtgtg
ggagtcctgactcagagctgtggaacccagcacctccactctgtcctgcaggccgccaac
tacaatggccacacatgtctgcacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc
cttcatcttgcggtggacctgcagaatcctgacctggtgtcactgttgttgaagtgtggg
gctgatgtcaacagagtcacgtaccagggctattctccataccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagttgctg
ccagagagtgaggatgaggagagctatgacacagaatcggagttcacagaggacgagctg
ccttatgatgactgtgtgcttggaggccagcgtctaacattatga

DBGET integrated database retrieval system