KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514480
Entry
107514480         CDS       T06036                                 

Gene name
RAD51
Definition
(RefSeq) DNA repair protein RAD51 homolog 1 isoform X1
  KO
K04482  DNA repair protein RAD51
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03440  Homologous recombination
ray03460  Fanconi anemia pathway
ray05200  Pathways in cancer
ray05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107514480 (RAD51)
   03460 Fanconi anemia pathway
    107514480 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514480 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107514480 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107514480 (RAD51)
   04121 Ubiquitin system [BR:ray04121]
    107514480 (RAD51)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107514480 (RAD51)
Membrane trafficking [BR:ray04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    107514480 (RAD51)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    107514480 (RAD51)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     107514480 (RAD51)
    RecA family proteins
     107514480 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107514480 (RAD51)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase ssDNA_TraI_N HHH
Other DBs
NCBI-GeneID: 107514480
NCBI-ProteinID: XP_016007725
LinkDB
Position
Unknown
AA seq 339 aa
MAMQMQLEANADTSLEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctatgcagatgcagcttgaagcaaatgcagatacttccctggaagaagagagcttt
ggcccacaacctatctcaagattagagcaatgtggcataaatgccaatgatgtgaagaaa
ttggaagaagctggatttcatactgtggaggctgttgcctatgctccaaagaaggagctc
ataaatattaaggggattagtgaagccaaagctgataaaattctgactgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgagttccaccaaaggagatcagagatcata
cagattacaactggctccaaagagcttgacaaactacttcaaggaggaattgagactgga
tccatcacagagatgtttggagaattccgaactgggaagacccagatctgtcatacattg
gctgtaacatgccagcttcccattgaccgaggtggaggtgaaggaaaggccatgtacatt
gacaccgagggtacctttaggccagaacgactgctagcagtggccgagagatatggcctc
tctggcagtgatgtcctagataatgttgcatatgctcgtggattcaacacagaccaccag
acccagctactttatcaagcatcagccatgatggtcgagtccaggtatgcactgctaatt
gtagacagtgccaccgccctctacagaacagactattctggtcggggcgaactttcagct
aggcagatgcacttggccagatttctgcggatgcttctgcgactcgctgatgagtttggt
gtggcagtggtaatcaccaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagatcctaaaaaacctattggaggaaatatcattgctcatgcctcaacaaccagactg
tacttgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctt
cctgaagctgaagctatgtttgccatcaatgcggatggagtaggagatgccaaagactga

DBGET integrated database retrieval system