KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514514
Entry
107514514         CDS       T06036                                 

Gene name
KCNMB4
Definition
(RefSeq) calcium-activated potassium channel subunit beta-4
  KO
K04941  potassium large conductance calcium-activated channel subfamily M beta member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107514514 (KCNMB4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107514514 (KCNMB4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107514514 (KCNMB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107514514 (KCNMB4)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107514514 (KCNMB4)
SSDB
Motif
Pfam: CaKB
Other DBs
NCBI-GeneID: 107514514
NCBI-ProteinID: XP_016007811
LinkDB
Position
Unknown
AA seq 210 aa
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATAANCTVLSVQ
QIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
RENQKNLESVMNWQQYWKDEIGSQPFTCYFNQFQRPDDVLLHRTHDEIVLLHCFLWPVVT
FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgaagctccgggtggcttacgagtacacggaagccgaggacaagagcatccggctc
ggcttgttcctcatcatctccggcgtcgtgtcgctcttcatcttcggcttctgctggctc
agtccggcgctgcaggatctgcaagccacggcggccaactgcacggtgctgtcggtgcag
cagatcggggaggtgttcgagtgcaccttcacctgtggcgccgactgtagaggcacctcg
cagtacccctgcgtccaggtctacgtgaacaactctgagtccaactccagggcgctgctg
cacagcgacgagcaccaactcctgaccaaccctaagtgctcctacatccctccctgtaag
agagaaaatcagaagaacttggaaagtgtcatgaattggcaacagtactggaaagatgag
attggttcccagccatttacttgctattttaatcaatttcaaagaccagatgatgtgctt
ctgcatcgcacgcatgatgagattgtcctcctgcattgctttctctggcccgtggtgaca
tttgtggtgggcgttctaattgtggtcctgaccatctgtgccaagagcctggcagtcaag
gcagaagccatgaagaagcgcaagttctcttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515946
Entry
107515946         CDS       T06036                                 

Gene name
KCNU1
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium channel subfamily U member 1
  KO
K05274  potassium large conductance calcium-activated channel subfamily M alpha member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107515946 (KCNU1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107515946 (KCNU1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107515946 (KCNU1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515946 (KCNU1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107515946 (KCNU1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 107515946
NCBI-ProteinID: XP_016010716
LinkDB
Position
Unknown
AA seq 1184 aa
MLLTKLRNDGGEDLGKTSCTTEIQAAFILSSFLTFFSGLLVLFVFRIIWKIIKKWQNIKG
TGIILELILSKKINLSQSRNLHLHGVFRDRIEMLLSAQTFVGQVLMILVFLLSIGSLVIY
FINSTDPVGSCSSYQDKTIPIDLTFNVFFSFYFGLRFLAADDKIKFWMEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPKILQILRAIKTSNSVKFSKLLSIVLSTWFTAAG
FIHLVENSGDPWLKGRNSQNLSYFESIYMVMATTSTVGFGDVVPKTSIGRTFIMFFTLGS
LVLFANYIPEMVDLFVNKRKHTSSYESLKGKKFIVVCGNITVDSVTAFLRNFLRHKSGEI
NTEIVFLGESPPSLELETIFKCYMAYTTFVSGSALKWEDLRRVAVDSAEACLIIANPLCS
DSHAEDTSNIMRVLSIKNYNPNTRVIIQILQSHNKVFLPKIPSWNWATGDNIICFAELKL
GFIAQGCLVPGLCTFLTSLFVEQNKKVSLKKPWQKYFLSSLKNKILTQRLSDDFAGMTFP
EVSRLCFVKMHLMLIAIEHKSMFSSYRCLILNPSAEVKLRKNTLGFFIAESAKEVRRAFL
YCATCHGDVYNPELIGLCSCKSKSYQHFTETTDMLRKSTIKGFHDTERQDSFAGERPSMI
SNLSTKTRGVEVRRRRSGKKLKKVTRRQAVASVVDLSAEGREQKATSLKVTWSFLYEDAE
CFDSSGMFHWCKATPLDNVILKRSDKSKHEFRNHVVVCIFGDAQSTLMGLRNFVMPLRAS
NYTRQELKDIVFIGNLDYLRREWRFLRNFPQIYILPGSALYSGDLRAVNIEECSMCAVLS
PPSKTSSSQTLVDTETIMTTLNLGSLRISCTARTPSESEGMSDYFSGYFGHSRHRRIPII
TELKNPSNIHFIEQLGGMEEHLPGTRLHLSTSFCTGSVFSGSFLDSLLATAFYNYHVLEF
LQMLVTGGISSQMEQNLRKDKFFGLMDSSTTIMSGRRRCKLGLLSLNRTILSDIQPKKTF
GQVFCGSLDNFGILCLGLYRMIDEEEHNPEHKRGVCGFVITRPVNEFNLLPSDLVFCAIP
FDVSCYKKVTSCQGPYETVHIMSLTSEAPPDINYSSAVAPVDQKTPQPSNTSVHTLEPKP
LSVSDSKRTFLTQNGKPSPQTHPGETTEKNEEESMTETVEEDTE
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgcttttaaccaagctgcgaaatgatggtggggaagacctgggaaaaacgtcctgcaca
actgagatccaagctgcgtttattctttcttccttcttgaccttcttcagtggactcctc
gtcttattcgttttcagaataatctggaagatcattaaaaaatggcaaaacatcaaggga
acaggaattattttggaactaatcttgtcaaagaaaatcaatttgagtcagtcaagaaat
ctccacctccatggagtatttcgtgaccgtatagaaatgttgctttcggcacagaccttt
gtggggcaggtgttgatgatccttgtctttctactaagcatcgggtctcttgtaatctat
ttcatcaactctactgacccagttggaagctgttcttcataccaagacaaaaccatccct
attgatttgactttcaatgttttctttagtttctattttggattaagatttttggcagct
gatgacaagatcaagttctggatggagatgaattcaattgtggacatctttaccatccca
ccaacctttatttcttattatttgaagagtaattggctgggtttaagatttttaagagcg
ttgcggctgctagaactccctaaaatcttgcaaattctgagagccatcaagactagcaat
tcagtgaagttttccaaactgttatcaatagttctcagtacttggttcacagctgcagga
ttcattcacctggtggaaaattctggtgatccctggctcaaaggtagaaattcacagaat
ttatcgtattttgagtccatttacatggtcatggcaacaacgtcaactgttggctttgga
gatgtggtacccaagacatccataggacggactttcatcatgttcttcaccctggggagt
ttggtactatttgcaaactatatccctgagatggtggacctttttgttaacaagaggaaa
cacaccagttcctatgaaagtctcaaaggaaagaagttcattgtggtctgtggaaacatc
acagttgacagtgtgactgccttcctaaggaattttcttcgccataaatcaggggaaatc
aacaccgagattgtttttctgggagagtctcctccttctttggaattggaaaccatattt
aaatgctacatggcgtacacaacttttgtttctggatctgcactgaagtgggaggatctg
aggcgagttgcggtggactctgcagaagcatgcctgattatagctaaccctttgtgcagt
gattcacatgctgaagacacttcaaacattatgagggtgctctctatcaagaactataac
cctaacaccagagtcatcatacagatacttcaatcccataacaaggtttttctgccaaag
attcccagctggaactgggctactggagacaatatcatctgctttgccgaattaaagctt
ggatttattgcccaaggctgtttggtgccaggcttgtgcacttttctcacatctctattc
gttgagcaaaacaaaaaggtttctcttaaaaagccctggcaaaaatattttttaagtagc
ctgaagaacaaaatcctgactcaacgtctctctgatgactttgctggaatgacttttcct
gaagtttcccggctctgttttgtgaagatgcacctcatgctgatagccatcgaacacaaa
tccatgttttccagttatcgttgtctgatactaaatccatctgcagaagtaaagctacgc
aagaacacattagggttctttattgctgaatcggcaaaagaagtcagaagagccttcctt
tactgtgccacctgtcacggtgatgtgtataatcctgagctaattggactatgtagctgc
aaaagcaagagctatcaacatttcacagagacaacagacatgctaaggaaaagcaccatc
aaaggattccatgatacagaaaggcaggattcttttgcaggggaacgaccaagcatgatt
agcaacttgagcactaaaaccaggggtgtggaggtgaggaggaggagaagtgggaaaaag
ctgaagaaagtgaccagaagacaagcagtagcaagtgttgtagacctgagtgctgagggc
agagagcagaaagccacctccctaaaagtaacttggtcttttctctatgaagatgccgaa
tgttttgatagcagcggcatgtttcactggtgtaaagcaacccctttggacaacgtgatc
ctgaaacgatctgacaagtcaaaacatgagtttcggaaccatgttgtagtatgtatcttc
ggagatgcccagtcaacactgatggggcttcggaatttcgtaatgcccttgagagctagc
aactatacccggcaggagctgaaggacattgtgttcatcgggaatctggattacctgcgg
agagaatggcgatttctccgaaatttcccccagatatacattctgcctggatctgcactc
tattctggagacctccgtgcagtcaacatagaggaatgttccatgtgtgctgtattatcc
cccccatccaagacatcgagcagccagacattggtagacacagagaccatcatgaccacc
ctcaacctaggatcactgaggataagctgcactgcccggacaccctcagagtcagagggg
atgtcagattactttagtggatattttggacactcaagacaccgaagaatccccatcatc
actgaactgaaaaatccttccaatatccacttcattgaacaacttggtgggatggaggag
cacctcccgggaacaagactgcatctcagcacttccttttgcacaggcagtgtcttttct
ggcagcttcttggattccctcctggccacagccttctacaattaccacgtcctggaattt
cttcagatgctggtgacaggagggataagttctcagatggaacaaaatttgcgtaaggat
aagttctttgggctgatggacagctctactacaattatgtctggaagaaggcggtgtaag
ctggggctcctgtccttaaaccgaaccattttgtcagacattcaaccaaaaaagaccttt
gggcaagttttctgtggctcattagataattttggaatcctgtgccttggcttataccgc
atgatagatgaagaggagcacaacccggagcataaaaggggagtatgcggatttgtgatt
actcggccagtcaatgagtttaacctgctgccctcagaccttgtgttttgtgccatccct
tttgatgtttcttgctacaaaaaagtcacttcatgtcaaggtccatatgaaactgtacat
ataatgtcactgacatcagaggcacctccagacataaattactcttctgcagttgcccca
gttgaccagaagacaccacaaccatcgaatacatcagtacatactttggagccaaaacct
ttgtctgttagtgattctaaaagaacttttttgactcagaatggtaagccatcaccccag
acacatccaggtgaaaccacggaaaaaaatgaagaagaaagcatgacggagaccgtagag
gaggacactgaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517571
Entry
107517571         CDS       T06036                                 

Gene name
KCNMB2
Definition
(RefSeq) calcium-activated potassium channel subunit beta-2
  KO
K04938  potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107517571 (KCNMB2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107517571 (KCNMB2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107517571 (KCNMB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107517571 (KCNMB2)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107517571 (KCNMB2)
SSDB
Motif
Pfam: CaKB KcnmB2_inactiv tRNA-synt_1g AAA_8
Other DBs
NCBI-GeneID: 107517571
NCBI-ProteinID: XP_016013953
LinkDB
Position
Unknown
AA seq 235 aa
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQQFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtttatatggaccagtggccggacctcttcatcttacagacacgatgagaaaagaaat
atttaccaaaaaatcagagaccacgatctcctggacaaaaggaaaactgtcacagcgctg
aaagcaggagaggacagggccattctcctgggactggccatgatggtgtgttccatcatg
atgtactttctgctgggaatcaccctcctgcgttcatacatgcagagtgtatggactgaa
gagtctcaatgcaccttgctgaatgcatccattacggaaacatttaattgctccttcagc
tgtggtccagactgctggaaactctctcagtacccctgcctccaggtgtacgttaacctg
acttcttccggtgaaaagctccttctctaccacactgaagagacgataaaaatcaatcag
aagtgctcctatatacctaagtgtggaaaaaattttgaagaatccatgtccctggtgaat
gttgtcatggaaaacttcaggaagtaccaacaattctcctgctattctgacccagaagga
aaccagaaaagcgtcatcctaaccaaactctacagttccaacgtgctgttccattcactc
ttttggccaacatgtatgatggctgggggtgtggcaatcgttgccatggtgaaactcaca
cagtacctctccctgctctgtgagaggatccaacggatcaatagataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518045
Entry
107518045         CDS       T06036                                 

Gene name
KCNMB3
Definition
(RefSeq) calcium-activated potassium channel subunit beta-3 isoform X1
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107518045 (KCNMB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107518045 (KCNMB3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107518045 (KCNMB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518045 (KCNMB3)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107518045 (KCNMB3)
SSDB
Motif
Pfam: CaKB tRNA-synt_1g Cyt_bd_oxida_II
Other DBs
NCBI-GeneID: 107518045
NCBI-ProteinID: XP_016014891
LinkDB
Position
Unknown
AA seq 283 aa
MQPFTIPVQITLQGGRRRQGRTAFSTSGRRRNIYHNGGDPLDVCKKLPSSAGEDRAILLG
FAMMGFSVLMFFLFGITILKPFLLSTQREESNCTIVHTHIMDDWMDCAFTCGVDCQGQGK
YPCLQVFVNLTHSGQKALLHYNEEAVQIDSKCFYTPKCHGDRNGLLDSALDIKEFFDHKN
GTPFSCFYNPDGLSEDVILIKKYDQMVIFHCLFWPSLTLLGGALIVGMVRLTQYLSLLCE
KYSTAPRGGVGGKVPYMKQHQFEVWSVGRSKGRSRETLRWWSN
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcagcccttcaccatccctgttcaaattacactccagggcggccggcggcgccaaggg
aggacagccttctctacctcagggaggaggagaaatatataccacaatggtggagatcca
ctagatgtgtgcaagaagctgccgtccagtgctggagaggaccgagccatacttttaggg
tttgcaatgatgggcttctcagttctaatgttcttcttgtttggaataaccatcctaaag
cctttcctgctcagcactcagagagaagaatcaaactgcactatcgtccacacacatatc
atggatgactggatggactgtgctttcacctgtggcgtggactgccaaggtcagggcaag
tacccatgtcttcaggtgtttgtgaacctcacccactcaggtcagaaagctctcctgcat
tataatgaagaggctgtccagatagattcaaagtgcttttacacacctaagtgccatgga
gataggaatggtttgctggacagtgctctggacataaaggaattcttcgaccacaaaaat
gggacccccttttcatgcttctacaatccagatggcctatctgaagatgtcattctcata
aaaaagtatgaccaaatggttatcttccattgtttattttggccttcactgacactgcta
ggtggtgccctgattgttggcatggtgagattaacacagtacctgtccctactatgtgaa
aaatatagcactgcacccagaggtggggtaggtggcaaagtaccgtatatgaaacagcat
caattcgaagtgtggagtgtggggaggagcaaaggaaggagtagagaaactttaagatgg
tggtccaattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518064
Entry
107518064         CDS       T06036                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1 isoform X1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
ray04924  Renin secretion
ray04970  Salivary secretion
ray04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107518064 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107518064 (KCNMA1)
   04924 Renin secretion
    107518064 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107518064 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    107518064 (KCNMA1)
   04972 Pancreatic secretion
    107518064 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518064 (KCNMA1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107518064 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N
Other DBs
NCBI-GeneID: 107518064
NCBI-ProteinID: XP_016014892
LinkDB
Position
Unknown
AA seq 1263 aa
MANGGGGGGSSGGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSVHEPKMDAL
IIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQ
KINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSI
GALVIYFIDSSKSRSADSLIPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLW
FWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLV
NLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAK
TTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESV
SNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKI
ESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWN
WKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEM
YTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEG
TLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLIYFEDEQPSTLSPKKKQRN
GGMRNSPSSSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSE
AAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWET
LHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKS
MQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELAKPGKLP
LVSVNQEKNSGTHILMITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDS
LMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLAL
LDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFE
LVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSIHSIPSTANRPNRPKSRESR
DKQNATRMNRMGQEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVE
DEC
NT seq 3792 nt   +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcagcagcggcggcggcggcggcggcggcggaggc
agcagtcttagaatgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcc
tcttcttcctcttcatcctcctcctcgtcctcggtccacgagcccaagatggatgcgctc
atcatcccggtgaccatggaggtgccgtgcgacagccggggccaacgcatgtggtgggct
ttcctggcctcctccatggtgactttcttcgggggcctcttcatcatactgctctggcgg
acgctcaagtacctgtggaccgtttgctgccactgcgggggcaagacgaaggaggcccag
aagattaacaatggctcaagccaggcggatggcactctcaagccagtggacgaaaaagag
gaggcggtggcagccgaggtcggctggatgacttctgtgaaggactgggcgggggtgatg
atatctgcccagacgctgaccggcagagtcctggtggtcttagtctttgctctcagcatt
ggtgcacttgtaatatacttcatagattcgtcaaagagccgctctgcagactctttgatc
ccaatagaatcctgccagaatttctacaaagatttcacgttacagatcgacatggctttc
aacgtgttcttccttctctactttggcttgcggtttattgcagccaatgataagctgtgg
ttctggctggaagtgaactctgtagtagatttcttcacagttcccccagtgtttgtgtct
gtgtacttaaacagaagttggcttggtttgagatttttaagagctctcagactgatccag
ttttcagaaattttgcagtttctgaatattcttaaaacaagtaattccatcaagctggtg
aatctgctctccatatttatcagcacatggctaacagcagctgggttcatccatttggtg
gagaattcaggggacccatgggaaaatttccaaaacaaccaggctcttacatactgggaa
tgtgtctatttactcatggttaccatgtccactgttggctatggggacgtgtatgcaaaa
accacacttgggcgtctcttcatggtcttcttcatcctcgggggactggccatgtttgcc
agctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcatat
agcgcggtcagtgggagaaagcacattgtggtctgtggacatatcactctggagagtgtt
tccaacttcctgaaggactttctgcacaaggaccgggacgatgtcaacgtggagatcgtt
tttcttcacaacatttcccctaacctggagcttgaagctctgttcaaacgacattttact
caggtggaattttatcagggttcagtcctcaatccacatgatcttgcaagagtcaagata
gagtcagcagatgcatgcctcatccttgccaataagtactgcgctgaccctgatgctgaa
gatgcctccaacatcatgagagtaatctccataaagaactaccatccgaagataagaatc
atcactcagatgctgcagtatcacaacaaggcccatctgctaaacatcccgagctggaat
tggaaagagggtgatgatgcaatctgcctcgcagagctgaagctggggttcatcgcccag
agctgcctggctcagggcctctccaccatgctcgccaacctcttctccatgaggtcattt
ataaagattgaggaagacacatggcagaaatactacctggaaggagtctcaaatgaaatg
tacacagaatatctctctagtgccttcgtgggtctgtccttccctactgtttgtgagctg
tgttttgtgaagctcaagctcctaatgatagccattgagtacaagtctgctaaccgcgag
agccgaagccgaaagcgtatattaattaatcctggaaaccaccttaagatccaagaaggt
actttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttactgc
aaggcctgtcatgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaacgg
ctgatatattttgaagatgagcagccctcaacgctgtcaccaaaaaaaaagcagcggaac
ggaggtatgcggaattcacccagctcctcgcccaaactgatgaggcatgaccccttgtta
attcccggcaatgatcagattgacaacatggactccaacgtgaagaagtatgactctact
gggatgtttcactggtgcgcacccaaagagatagagaaagtcatcctgacccgaagtgaa
gctgccatgactgtcctgagtggccatgttgtggtctgcatctttggtgatgtcagctca
gccctgattggcctccggaacctggtgatgccactacgtgccagcaactttcattaccac
gagctcaagcacatcgtgtttgtgggctccattgagtacctcaagcgggaatgggagacg
cttcataacttccccaaagtgtccatattgcctggtacgccattaagtcgggctgattta
agggccgtcaacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataat
attgatgatacttcgctgcaggacaaggaatgcatcttggcgtcactcaacatcaaatct
atgcagtttgatgacagcattggggtcttgcaggctaattcccaaggtttcacgcctcca
ggaatggacagatcctctccagacaacagcccagtgcacgggatgttacgccagccatcc
atcacgactggggtcaacatccctatcatcactgaactagctaaacctggcaagttgcct
ttggtatcagtcaatcaggaaaaaaacagtgggacacacattctaatgataactgaactg
gtgaacgatactaatgttcagtttttggaccaagacgatgatgatgaccccgacacagaa
ctgtacctcacgcagccattcgcatgtgggacagcatttgccgtcagtgtcctggactcg
ctcatgagtgcgacatacttcaacgacaatatccttaccctgatacggaccctggtgacc
ggaggagccacgccagagctcgaggctctgattgctgaggagaatgcgcttcgagggggc
tacagcactccccagacactggccaacagggaccgctgccgagtagcccagttagcactg
ctggatgggccctttgcagacttaggggatggtggttgttatggtgatctgttctgcaaa
gctctgaaaacatataatatgctttgttttggaatttatcggctgagagatgctcatctc
agcacccctagccaatgcacaaaaaggtacgtcatcaccaaccccccatacgagtttgag
cttgtgccgacggacctgatcttctgcttaatgcagtttgaccacaacgccggccagtcg
cgggccagtctctcccattcctcccactcgtcccagtcctccagcaagaagagctcgtcc
attcactccatcccatccacagcaaaccgaccgaaccggcccaagtcccgggagtcccga
gacaaacagaatgcaacaaggatgaatagaatgggccaagaaaagaaatggtttacagat
gaaccggataatgcctatcccagaaacattcaaatcaagcccatgagtacccacatggct
aaccagatcaaccaatataaatccacaagcagcttgattccaccaatcagagaagttgaa
gatgaatgttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518473
Entry
107518473         CDS       T06036                                 

Gene name
KCNMB1
Definition
(RefSeq) calcium-activated potassium channel subunit beta-1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107518473 (KCNMB1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107518473 (KCNMB1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107518473 (KCNMB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518473 (KCNMB1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107518473 (KCNMB1)
SSDB
Motif
Pfam: CaKB
Other DBs
NCBI-GeneID: 107518473
NCBI-ProteinID: XP_016015657
LinkDB
Position
Unknown
AA seq 191 aa
MGKKLVMAQKRGETRALCLGVAMVACAVITYYILGTTVLPLYQKSVWTQESMCHLIETNI
RDQEELEGKKVAQYPCLWVNVSAVGRWAVLYHTEDTRDQNQQCSYIPRSLSNYPTARADV
EKVRDRFHELRVFHCFSATRANETSVLYQRLYGPQALLFYLFWPTFLLTSGLLIIAMVKV
NQSLSILAAQK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcggggagagacgcgcgccctctgcctgggc
gtggccatggtggcgtgcgccgtcatcacctactacatcctgggcacgaccgtgctgccc
ctctaccagaaaagtgtgtggacccaggaatccatgtgccatctgattgagaccaacatc
agggaccaggaggagctggagggcaagaaggtggcccagtacccgtgcctgtgggtcaac
gtgtccgccgtgggccggtgggccgtgctgtatcacacagaggacactcgggaccagaac
cagcagtgctcctacattccccgcagcctaagcaactacccgacggcccgggccgacgtg
gagaaagtcagagacaggttccacgagctccgggttttccactgcttctcggcaacgcgg
gcgaatgagaccagcgtcctgtaccagcgcctctacgggccccaggccctcctcttctat
ctcttctggcctaccttcctgctgaccagcggcctcctcatcatcgccatggtgaaggtc
aaccagtccctctccatcctggcagcccagaagtga

DBGET integrated database retrieval system