KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514532
Entry
107514532         CDS       T06036                                 

Gene name
CD40
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 5 isoform X1
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04064  NF-kappa B signaling pathway
ray04514  Cell adhesion molecules
ray04620  Toll-like receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray05144  Malaria
ray05145  Toxoplasmosis
ray05166  Human T-cell leukemia virus 1 infection
ray05169  Epstein-Barr virus infection
ray05202  Transcriptional misregulation in cancer
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05322  Systemic lupus erythematosus
ray05330  Allograft rejection
ray05340  Primary immunodeficiency
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107514532 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107514532 (CD40)
   04514 Cell adhesion molecules
    107514532 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107514532 (CD40)
   04672 Intestinal immune network for IgA production
    107514532 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107514532 (CD40)
  09163 Immune disease
   05310 Asthma
    107514532 (CD40)
   05322 Systemic lupus erythematosus
    107514532 (CD40)
   05320 Autoimmune thyroid disease
    107514532 (CD40)
   05330 Allograft rejection
    107514532 (CD40)
   05340 Primary immunodeficiency
    107514532 (CD40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107514532 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107514532 (CD40)
   05169 Epstein-Barr virus infection
    107514532 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    107514532 (CD40)
   05145 Toxoplasmosis
    107514532 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ray04050]
    107514532 (CD40)
   04090 CD molecules [BR:ray04090]
    107514532 (CD40)
Cytokine receptors [BR:ray04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107514532 (CD40)
CD molecules [BR:ray04090]
 Proteins
  107514532 (CD40)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 107514532
NCBI-ProteinID: XP_016007825
LinkDB
Position
Unknown
AA seq 285 aa
MIRLPLQCLFWGFLLTAVHPELSTACRENQYPINSQCCNLCPAGEKLVNDCTETTNTECS
PCSEGEFLGTWNNERHCHQHKYCDPNLGLLVKTNGTSKTDTTCMCKEGQHCISNACESCI
PHRSCPPGFGVQRIATGVSDTVCKPCPDGYFSNVSSAFEKCHRWTSCESKNLVELQAGTN
KTDVVCGFQYRMRALVLIPVIMVILTIVLLVPVCISESQMSKQGKVTKEPENKGCHGSLG
QRQDPEEDDFPVPHSTAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 858 nt   +upstreamnt  +downstreamnt
atgattcgtcttcctctgcagtgtctcttctggggcttcttgttgaccgccgtccaccca
gaactttccactgcatgcagagaaaatcaatacccaataaacagtcagtgctgtaatttg
tgcccagcaggagagaaactggtgaatgactgcacggagaccaccaacacagaatgttct
ccttgtagtgaaggcgaattcctaggaacctggaacaatgagagacactgtcatcagcac
aaatactgtgaccccaacctagggctcctggtcaagacaaatggcacctcgaaaacagac
acgacttgcatgtgtaaggaaggccaacactgtatcagcaatgcctgtgaaagctgcatc
ccgcacagatcatgcccccctggctttggagtccagcggatcgctacaggggtttctgat
acagtctgcaagccttgcccagatggctacttttccaatgtgtcatctgcttttgaaaag
tgtcaccgttggacaagctgtgagtctaagaacctggtggagttacaagcagggactaac
aagacggatgttgtctgcggtttccagtatcggatgagagccctggtgctgattcctgtc
atcatggtgatcctgactattgtcctgttggtgcccgtctgtatcagtgagtcccagatg
agtaagcaaggaaaggtgaccaaggagccagaaaataagggctgccatggatccctaggc
caacgacaggatcccgaggaggatgattttcctgtcccccactccaccgcaccggtgcag
gagaccttacatgggtgccagccggtcacacaggaagatggcaaagaaagccgcatctca
gtgcaggagagacagtga

DBGET integrated database retrieval system