KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514533
Entry
107514533         CDS       T06036                                 

Gene name
SLC12A5
Definition
(RefSeq) solute carrier family 12 member 5 isoform X1
  KO
K23967  solute carrier family 12 (potassium/chloride transporter), member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107514533 (SLC12A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107514533 (SLC12A5)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   107514533 (SLC12A5)
SSDB
Motif
Pfam: AA_permease SLC12 AA_permease_2
Other DBs
NCBI-GeneID: 107514533
NCBI-ProteinID: XP_016007828
LinkDB
Position
Unknown
AA seq 1139 aa
MSRKFTVTSLPPAGPAGTPDRESHRDSAAEILHLSGEDAKGDGNPKESSPFINSTDTEKG
KEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRM
GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNG
VVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAE
DASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFLNATCDEYFTR
NNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERQGMPSVGLADGAPIDMDHPYVFSDMT
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACI
EGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDG
IVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGA
EKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQ
LKAGKGLTIVGSVLEGTFLDNHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHL
IQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGN
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDES
RGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEG
EADPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLN
EVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgagccgtaagtttactgtcacctcgctgcccccagcagggcccgcggggactccagat
cgagagtcccaccgggattcggccgctgagatcctccacctctcaggggaagacgccaaa
ggtgatggcaacccgaaggagagcagccccttcatcaacagcaccgacacagagaaggga
aaggagtacgatggcaagaacatggccctgtttgaggaggagatggacaccagccccatg
gtatcctccctgctcagtggcctggccaactacaccaacctgccccagggaagtagggag
catgaagaggcagaaaacaatgagggtggaaaaaagaagccggtgcaggccccacgcatg
ggcaccttcatgggcgtgtacctaccgtgcctgcagaatatctttggtgtcattctcttc
ctgcgactcacttgggtagtgggcattgcaggcatcatggagtccttctgcatggtcttc
atctgctgctcctgtacgatgctcacggccatctccatgagtgcgattgcaaccaatggg
gtcgtacctgctggcggctcctactacatgatttccaggtctctgggcccagagtttggg
ggcgccgtgggcctctgcttctatctgggcactacctttgctggggccatgtacatcctg
ggcaccatcgaaatcctgctggcttacctcttcccagctatggctatttttaaggcagaa
gatgctagcggggaggcagcagccatgttgaacaatatgcgtgtgtatggcacctgtgtg
ctcacctgcatggccacagtggtgttcgtgggtgtcaagtacgtcaacaagtttgccctt
gtcttcctgggttgtgtcatcctctccatcttggccatctatgctggggttatcaaatct
gccttcgacccacccaacttcccgatctgcctcctagggaaccgcacactgtctcgccat
ggctttgatgtctgtgccaagctggcttgggaaggaaatgagacggtgaccacaaggctc
tggggccttttctgttcctctcgctttctcaatgccacctgtgatgagtacttcacccga
aacaatgtcacagagatccagggcattcctggcgctgccagtggcctcatcaaagagaac
ctctggagctcctacctgaccaagggggtgattgtggaaaggcaggggatgccctcggtg
ggcctggctgatggcgcccctatcgacatggaccatccttatgtcttcagtgatatgacc
tcctacttcactctgctggttggcatctacttcccctcggtcacagggatcatggccggt
tctaaccgctccggggacctgcgggatgcccagaagtcaattcccactggcaccatcttg
gccatcgccaccacctctgctgtctatatcagctctgttgttctgtttggggcctgcatt
gagggggtcgtcctgagggacaagtttggcgaagctgtgaatggcaacctggtggtgggc
acactggcctggccgtccccctgggttatcgtcattggatccttcttctccacctgtggg
gctgggctgcagagcctcacaggggccccacgcctgctgcaggccatctcccgggatggc
attgtgcccttcctgcaggtctttggccacggcaaagccaatggagagccaacgtgggcc
ttactcctgaccgcctgcatctgtgagatcggcatcctcattgcatctctcgacgaggtc
gcccctattctctccatgttcttcttgatgtgctacatgttcgtgaacttggcctgtgca
gtacagacgctgctgaggacgcccaattggaggccccgctttcgatattaccactggaca
ctctccttcctgggcatgagcctctgcctggccctcatgttcatctgctcctggtattac
gccctggtggccatgctcattgctgggctcatctacaagtacatcgagtaccgtggggca
gagaaggagtggggcgatgggatccgaggcctgtctctcagcgctgctcgctacgccctc
ttacgcctggaggaagggcctccacacaccaagaactggcggccacagctgctggtgctg
gtgcgtgtggaccaagaccagaatgtggtccacccacagctgctctcgctgacatcccag
ctcaaggcagggaagggcctgaccattgtgggctctgtccttgagggcacatttctggac
aaccacccccaggcccagcgggcagaggagtctatccggcgcctgatggaggcagagaaa
gtgaaaggcttctgccaggtagtgatttcctccaacctgcgcgatggtgtgtcccatctg
atccagtctgggggccttggggggctgcagcacaataccgtgctagtcggctggccccgc
aactggcgacagaaggaagatcatcagacctggaggaacttcatcgagctggtccgggaa
accactgctggtcacctggccctgctggtcaccaagaacgtttctatgtttcccgggaac
cccgagcgcttctccgagggcagcatcgacgtctggtggattgtgcacgacggaggcatg
ctcatgctgctgcccttcctgctgcggcaccacaaggtctggcggaaatgcaagatgcgc
attttcactgtggcccagatggatgacaacagtatccagatgaagaaggacctgaccaca
tttctgtaccatttacgtatcactgcagaggtcgaggtggtggagatgcatgagagcgac
atctcagcttacacctacgagaagacattggtgatggagcagcgttcccagatcctcaaa
cagatgcatttaaccaagaacgagcgggagcgggagatccagagtatcacagatgagtct
cgtggctcaatccggagaaagaatccagccaacactcggctccgcctcaatgtcccagaa
gagacggccggtgacagtgaggagaaaccagaagaagaggtgcagctgatccatgaccag
agtgctcccagctgccccagcagctcaccatcccctggggaggagcctgagggggagggc
gaggcagatcctgagaaggtgcatctcacctggaccaaggacaagtcggtggcagagaag
aataaggggcccagtcctgtctcctccgagggcatcaaggacttcttcagcatgaagccg
gagtgggagaacttgaaccagtccaatgtgcggcgcatgcacacggctgtgcggctgaac
gaggtcatcgtgaagaaatcccgagatgccaaacttgttttgctcaacatgcctgggcct
ccccgcaaccgcaacggtgatgaaaattacatggagttcctcgaggtcctcaccgagcac
ctggaccgggtgatgctggtccgcggcggcggccgcgaggtcatcaccatctactcctga

DBGET integrated database retrieval system