KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514682
Entry
107514682         CDS       T06036                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04630  JAK-STAT signaling pathway
ray04921  Oxytocin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107514682 (CDKN1A)
   04630 JAK-STAT signaling pathway
    107514682 (CDKN1A)
   04066 HIF-1 signaling pathway
    107514682 (CDKN1A)
   04068 FoxO signaling pathway
    107514682 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    107514682 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107514682 (CDKN1A)
   04115 p53 signaling pathway
    107514682 (CDKN1A)
   04218 Cellular senescence
    107514682 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107514682 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    107514682 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514682 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    107514682 (CDKN1A)
   05206 MicroRNAs in cancer
    107514682 (CDKN1A)
   05205 Proteoglycans in cancer
    107514682 (CDKN1A)
   05203 Viral carcinogenesis
    107514682 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107514682 (CDKN1A)
   05212 Pancreatic cancer
    107514682 (CDKN1A)
   05225 Hepatocellular carcinoma
    107514682 (CDKN1A)
   05226 Gastric cancer
    107514682 (CDKN1A)
   05214 Glioma
    107514682 (CDKN1A)
   05216 Thyroid cancer
    107514682 (CDKN1A)
   05220 Chronic myeloid leukemia
    107514682 (CDKN1A)
   05217 Basal cell carcinoma
    107514682 (CDKN1A)
   05218 Melanoma
    107514682 (CDKN1A)
   05211 Renal cell carcinoma
    107514682 (CDKN1A)
   05219 Bladder cancer
    107514682 (CDKN1A)
   05215 Prostate cancer
    107514682 (CDKN1A)
   05213 Endometrial cancer
    107514682 (CDKN1A)
   05224 Breast cancer
    107514682 (CDKN1A)
   05222 Small cell lung cancer
    107514682 (CDKN1A)
   05223 Non-small cell lung cancer
    107514682 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107514682 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107514682 (CDKN1A)
   05161 Hepatitis B
    107514682 (CDKN1A)
   05160 Hepatitis C
    107514682 (CDKN1A)
   05163 Human cytomegalovirus infection
    107514682 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107514682 (CDKN1A)
   05169 Epstein-Barr virus infection
    107514682 (CDKN1A)
   05165 Human papillomavirus infection
    107514682 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107514682 (CDKN1A)
   01522 Endocrine resistance
    107514682 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107514682
NCBI-ProteinID: XP_016008118
LinkDB
Position
Unknown
AA seq 166 aa
MSEPSRDAHPVPQGSKACRRLFGPVDSEQLRRDCDALMASCVQEACERWNFDFVTETPLE
GNFAWEPVWGLGLPKVYLPSGPWGTRDNLGGGKRPSSSPVLLQGITQEDHVDLSLSCTLV
PRSSEQAEGSPGGPGTSQGRKRRQTNMTGEETEAQRAAAKNPTANL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcggagccatcgcgagatgcccatccagtcccccagggcagcaaggcctgtcgccgc
ctcttcggcccagtggacagtgagcagctgcgccgagactgcgatgcactaatggccagc
tgtgtgcaggaggcctgtgagcgatggaacttcgactttgtcactgagacaccgctggag
ggcaactttgcctgggagcctgtgtggggcctgggcctgcccaaggtctacttgccctcg
gggccctgggggacccgggacaacctgggaggaggcaagcggcctagcagctcacctgtc
ctgctgcaggggataactcaggaggaccacgtggacctgtctctgtcttgcaccctcgtg
cctcgctcctctgagcaggctgaggggtcgccaggtgggcctggcacctctcagggccga
aaacggcggcagaccaacatgacaggtgaggaaactgaggctcaaagagctgcagccaag
aatcccacagcaaatttgtag

DBGET integrated database retrieval system