KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514777
Entry
107514777         CDS       T06036                                 

Gene name
GPR119
Definition
(RefSeq) glucose-dependent insulinotropic receptor
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107514777 (GPR119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107514777 (GPR119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107514777 (GPR119)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    107514777 (GPR119)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107514777
NCBI-ProteinID: XP_016008281
LinkDB
Position
Unknown
AA seq 335 aa
MESSFSFGVILAVLASLIIVANALVAVAVLLLIHKNDGVSLCFTLNLAMADTLLGVAISG
LVTDHLSSLAWPTQKTLCTLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL
MAGTCIAGLWLVSYLIGFLPLGVTVFQQTTYQGPCSFFAVFHPRFMLTLSCIGFFPVLLL
FVFFYCDMLKIASVHSQQIRKMEHTGAVTGAYRPPRSPSDFKAVRTVAVLIGSFTLSWTP
FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRQQLYQMALGVKKG
LTSFLLLLSARDGGPEESKERSCYITTISHSQLDD
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggagtcatctttctcatttggagtgatccttgctgttctggcctcccttattattgtt
gctaatgccctagtggctgtggctgtgctattgttgatccacaagaatgatggtgtcagt
ctctgtttcaccttgaatctggctatggctgacaccttgcttggtgtggccatttctggc
ctagtcacagaccatctctccagcctggcatggcccacacagaagaccctgtgtactctt
cggatggcatttgtcacttcttctgcagctgcctctgtcctcacggtcatgctgattgcc
tttgacaggtaccttgccatcaagcagcctctccgctacttccagatcatgaatggtctc
atggctggcacctgcattgctgggctatggttggtgtcctacctcatcggcttcctccca
ctcggagttacagtattccagcagaccacttaccaggggccctgtagcttcttcgctgta
tttcacccacgcttcatgcttacactctcctgtattggcttcttcccagttttgctcctc
tttgtcttcttctattgtgacatgctcaagattgcctctgtgcacagccagcagattcga
aagatggaacacacaggagccgtgactggagcttaccggcctccacggagtcccagtgac
ttcaaggctgtccgcactgtggcggttctcattgggagcttcactctgtcctggactcca
ttccttatcactggcattgtgcaggtagcctgccaagagtgccacctctacctagtgctg
gaacggtacctgtggctgcttggtgtgggcaactccctgctcaacccactaatctatgcc
tattggcagaaggaggtacggcagcagctctaccaaatggccctgggagtgaagaagggg
ctcacctcattcctcctccttctctcagccagggatggtggcccagaggagtcgaaggaa
aggtcctgttacattaccactatctcccactcacagcttgatgactaa

DBGET integrated database retrieval system