KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514919
Entry
107514919         CDS       T06036                                 

Gene name
CA2
Definition
(RefSeq) LOW QUALITY PROTEIN: carbonic anhydrase 2
  KO
K18245  carbonic anhydrase 2 [EC:4.2.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00910  Nitrogen metabolism
ray01100  Metabolic pathways
ray04964  Proximal tubule bicarbonate reclamation
ray04966  Collecting duct acid secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    107514919 (CA2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    107514919 (CA2)
   04972 Pancreatic secretion
    107514919 (CA2)
   04976 Bile secretion
    107514919 (CA2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107514919 (CA2)
   04966 Collecting duct acid secretion
    107514919 (CA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107514919 (CA2)
Enzymes [BR:ray01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     107514919 (CA2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107514919 (CA2)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 107514919
NCBI-ProteinID: XP_016008626
LinkDB
Position
Unknown
AA seq 260 aa
MSHHWXYGAHNGPERWHEDFPIAKGKRQSPVDIDTKAAAHDPSLKPLCVGYERATSRRIL
NNGHSFNVEFDDSQDKAVLAGGPLQGTYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHL
VHWNTKYKDFKEAVQKPDGLAVLGVFLKIGDANPGLQKVTDALDSIKTKGKSADFPNFDP
CGLLPCSLDFWTYPGSLTTPPLLECVTWLVLREPITVSREQMLKFRKLNFNAEGEAEQLM
VDNWRPAQPLHCRQVKASFR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtcccaccactggnggtacggcgcgcacaacggcccggagcgctggcatgaggacttc
cccatcgccaagggcaagcgccagtcccctgtggacattgacaccaaagcggccgctcac
gacccctcgctgaagccgctgtgcgtgggctacgagcgggccacgtcccggagaatcctc
aacaacggtcactctttcaacgtggagttcgatgactcccaggacaaagcagtgctggcg
ggagggcccctacagggcacctacagactgatccagttccacttccactggggctcatcc
gacgggcaaggctctgagcacaccgtgaacaaaaagaaatacgctgccgagcttcacttg
gttcactggaacaccaaatacaaggactttaaagaagccgtgcagaaacccgacggactg
gccgttctgggcgtttttctgaagatcggcgacgctaaccccggcctgcagaaggtcacg
gacgcgctggactccatcaaaacgaagggtaagagcgccgacttcccgaacttcgaccct
tgcggcctcctcccctgcagcctggacttctggacctaccccggctcgctgaccacgccg
ccgctgctggagtgcgtgacctggctggtgctgcgggagcccatcaccgtgagcagggag
cagatgctgaaattccgcaaacttaacttcaatgcggagggcgaagccgagcaactcatg
gtggacaactggcggccggctcagccactgcactgcaggcaggtcaaggcgtccttccgg
tga

DBGET integrated database retrieval system