KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514938
Entry
107514938         CDS       T06036                                 

Gene name
GRM5
Definition
(RefSeq) LOW QUALITY PROTEIN: metabotropic glutamate receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04540  Gap junction
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107514938 (GRM5)
   04072 Phospholipase D signaling pathway
    107514938 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107514938 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107514938 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107514938 (GRM5)
   04720 Long-term potentiation
    107514938 (GRM5)
   04723 Retrograde endocannabinoid signaling
    107514938 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514938 (GRM5)
   05016 Huntington disease
    107514938 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    107514938 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107514938 (GRM5)
G protein-coupled receptors [BR:ray04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   107514938 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Other DBs
NCBI-GeneID: 107514938
NCBI-ProteinID: XP_016008651
LinkDB
Position
Unknown
AA seq 1208 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQ
HRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYKGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSTIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTAV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNERSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGGAGASAXGHGGASCAAAGPSAPEPPDAGPKALYDVAEAEEQFPAPARPRSPSPIST
LSRRAGSASRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNSMMLSTAG
PGPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGTQPAGAAPPAGGAARETP
AAGPEAAAGKQELEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRD
YTQSSSSL
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcctgcttttgaaagaagatgtccgtgggagtgca
cagtccagcgagaggagggtggtggctcacatgccaggtgacatcattattggagctctc
ttttctgtccaccaccaacccaccgtggacaaagttcatgagaggaagtgtggggcagtt
cgtgaacagtatggcattcagagagtggaggccatgctgcacaccctggaaaggatcaac
tcagatcccacacttttgcccaacatcacactgggctgtgagataagggattcctgctgg
cattcggctgtggccctagaacagagtattgagttcataagggactccctcatttcttcg
gaagaagaagaaggtttggtgcgctgtgtggatggctcttcctcttcttttcgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaac
ttactccagctttttaacatacctcagattgcctattcagcaacaagcatggatctgagc
gacaaaactctgttcaagtatttcatgagggttgtgccttcagatgcccagcaagcacgg
gccatggtggacatagtgaagagatataactggacctatgtgtcagctgtgcacacagaa
ggcaactatggagaaagtggaatggaagctttcaaagatatgtcagccaaggaagggatt
tgcatcgctcactcctacaaaatctacagcaatgctggggagcagagtttcgataaactg
ctaaagaagctcaggagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgactgtgagaggtctgctgatggccatgaggcgcctgggtctagctggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggaatcacaatcaagctccaatctcctgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaacctccgaaacccatggtttcaagaattttggcag
catcgttttcagtgccggctggaagggtttgcacaagagaacagcaaatacaacaagact
tgcaatagttctctgactctgagaacacatcacgtccaagattccaaaatgggatttgtg
atcaatgcgatctattccatggcctatggactccacaacatgcagatgtctctctgtcca
ggctataagggcctctgcgatgcaatgaagcctatcgatggacggaaacttttggactcc
ctgatgaaaaccaactttactggggtttctggagatatgatcctatttgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaagaaatggggaaagattattttgat
tatatcaatgttggaagctgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaccatcatcagatctgtgtgtagtgaaccatgtgagaaaggccagata
aaggtgatccggaagggagaagtcagctgttgttggacctgtacaccatgtaaagagaat
gagtatgtctttgatgagtatacttgcaaggcgtgccagctggggtcctggccaactgat
gaccttacaggttgtgatttgatcccagtacagtatctccgctggggtgaccctgagccc
attgcagctgtggtgtttgcctgcctcggcctgctggccaccttgtttgttaccgcagtc
ttcatcatttaccgtgacacgccagtagtcaagtcctccagcagggaactctgctacatt
atccttgctggcatctgcctaggctacttatgtaccttctgcctcattgcaaagcccaaa
cagatttattgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaaccaagaccaaccgtattgcgaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagccccgattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgatataatg
cacgactacccaagcattcgggaagtctacctgatttgtaataccaccaacctaggagtt
gtcactcctcttggatacaatgggttgctgattttgagctgtaccttctatgctttcaag
accagaaacgtcccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacc
acctgcattatatggctggcctttgtgccaatctactttggcagcaactataaaatcatc
accatgtgcttctcggtcagcctcagtgccacggtggcactgggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaatgtgcgcagcgccttcaccacttcc
accgtggtgcgcatgcacgtgggggatggcaagtcctcctccgcagccagcagatccagc
agcctggtcaacttgtggaagaggagaggctcctctggggaaaccctaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagctccaacggaaaatccgtcacgtgggcccagaat
gagaggagcagtcgggggcagcacctgtggcagcgactgtccatccacatcaacaagaaa
gagaatcccaaccagacggctgtcatcaagcccttccccaagagcaccgagagccgcggc
ctgggcgcgggcggcgcgggcgccagcgctnggggtcacggcggcgcgagctgcgcggcc
gcgggccccagcgcccccgagcccccggacgcgggccccaaagcgctgtacgacgtggcc
gaggcggaggagcagttccccgcgcccgcgcgcccgcgctcgccgtcgcccatcagcacg
ctgagccgccgcgcgggctccgccagccgcacggacgacgacgtgccgtcgctgcactcg
gagcccgcggcgcgcagcagctcctcgcagggctcgctcatggagcagatcagcagcgtg
gtgacccgcttcaccgccaacatcagcgagctcaactccatgatgctgtccaccgcgggc
cccggccccggcgtgggcgccccgctctgctcgtcctacctgatccccaaagagatccag
ctgcccacgaccatgacgacgttcgccgaaatccagcctctgcctgccatcgaggtcacg
ggcggcacgcagcccgcgggggcggccccgccggctgggggcgctgcccgggagaccccc
gcggccgggccggaggctgcggccggcaagcaggagctggaggagttggtggctctcacc
cctccgtcccccttcagagactcggtggactcagggagtacaacccccaactcgccagta
tccgagtcggccctctgtatcccatcgtctcccaaatatgacacactgatcataagagat
tacactcagagctcctcgtcgttgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518526
Entry
107518526         CDS       T06036                                 

Gene name
GRM1
Definition
(RefSeq) metabotropic glutamate receptor 1 isoform X1
  KO
K04603  metabotropic glutamate receptor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04540  Gap junction
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04915  Estrogen signaling pathway
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107518526 (GRM1)
   04020 Calcium signaling pathway
    107518526 (GRM1)
   04072 Phospholipase D signaling pathway
    107518526 (GRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107518526 (GRM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107518526 (GRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107518526 (GRM1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107518526 (GRM1)
   04720 Long-term potentiation
    107518526 (GRM1)
   04730 Long-term depression
    107518526 (GRM1)
   04723 Retrograde endocannabinoid signaling
    107518526 (GRM1)
  09157 Sensory system
   04742 Taste transduction
    107518526 (GRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107518526 (GRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    107518526 (GRM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107518526 (GRM1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107518526 (GRM1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107518526 (GRM1)
G protein-coupled receptors [BR:ray04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   107518526 (GRM1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Spt20 DUF5438 TFIIA DUF2318 AAA_34
Other DBs
NCBI-GeneID: 107518526
NCBI-ProteinID: XP_016015759
LinkDB
Position
Unknown
AA seq 1206 aa
MVRLLLLFFPAIFWEMSLLPRSPGRRVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGLNRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLE
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSTFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTDADRYDYVHVGTWHEGVLNIDDYKIQMNKSGLVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACELGWWPNADLTGCEPIPIRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNTNSNGKSVSWSEPGG
RQVPKAQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEED
DAQTVGFSAPSSPSMVVHRRVPTAVSTPPLLPHLAAEETPLFLAEPAIPRGLPPPLQQPP
PPALPQQQQQQQQQQQQQQKSLMDQLQGVVNNFSTGIPDFNAVLAVPGGPGNGVRSLYPP
PAPQQHLQMLPLQLSALGEEPASPAAEDEDEDDSERFKLLQEYLYEREGNTEEDELEEDE
EDPQAASKPTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYK
QSSSTL
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggtccggctcctcttgcttttcttcccagcgatcttttgggagatgtcccttctcccc
agaagccccggtaggagagtgttgctggcgggagcctcgtctcagcgctcggtggccaga
atggacggagatgtcatcatcggggcgctcttctcagtgcaccaccagcctcccgccgag
aaggtgcccgaaaggaaatgcggggagatcagggagcagtacggcatccagcgggtggag
gccatgttccacacgttggataagatcaacgcggacccagtcctcctgcccaacatcacc
ctgggcagtgagatccgggactcctgctggcactcctccgtggctctggagcagagcatt
gagttcatcagggactctctgatttccattcgagacgagaaggatggactcaaccggtgc
ttgcctgacggccagtccctccccccaggcaggactaagaagcccattgcgggtgtgatc
ggccctggctccagctccgtggccattcaagtgcagaacctgctgcagctctttgacatc
ccccagatcgcatattccgccacgagtatcgacctgagtgacaaaactttgtataaatac
ttcctgagggttgtcccttctgacactttgcaggcaagggcgatgcttgatatagtcaag
cgttacaattggacctatgtctctgcagtccacacagaagggaattatggagagagtgga
atggacgctttcaaagagcttgctgctcaggaaggtctctgcatcgcccattcggacaaa
atctacagcaatgctggcgagaagagctttgaccgactcctgcgcaagctccgagaacgg
cttcccaaggccagagtggtggtctgcttctgcgaaggaatgaccgtccgaggcctcctg
agcgccatgcggcgcctcggcgtggtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcattgaaggttatgaggtggaagccaacgggggaatcacaata
aagctgcagtctccagaggtcaggtcatttgatgattatttcctgaaactaaggctggaa
actaatacaaggaatccctggttccctgagttctggcaacatcggttccagtgccgccta
ccaggacaccttctggaaaatcccaactttaaaagaatctgcacaggcaatgaaagctta
gaagaaaactatgtccaggacagtaagatggggtttgtcatcaacgccatctacgccatg
gcacatggactgcagaacatgcaccatgctctctgcccgggccacgtgggcctctgcgat
gccatgaagcccatcgacggcagcaaactcctagacttcctcatcaagtccacgttcatc
ggtgtgtctggagaagaggtgtggtttgatgagaaaggggatgctcctggaaggtatgac
atcatgaatctgcagtacaccgatgccgaccgctatgactatgtacatgtcggaacctgg
catgagggggtgttaaacatcgacgactacaaaatccagatgaacaagagcgggctggtg
cggtccgtgtgtagcgagccttgcttaaagggtcagattaaggtcatacggaaaggtgaa
gtgagttgctgctggatttgcacggcttgtaaggagaatgaatacgtgcaagacgagttc
acctgcaaagcttgcgaactggggtggtggcccaacgcagatctcacaggctgcgaaccc
attcctatccgctaccttgagtggagcaatatagaatccatcatagccatcgccttctcc
tgcctgggcatcctggttaccttgttcgtcactctcatcttcgtgttgtatcgggacacg
ccggtggtcaaatcctccagtcgggagctctgctacatcatcctagctggcatcttcctc
ggttacgtgtgccctttcactctcattgccaaacctaccaccacatcgtgctacctccag
cgtctcctggtcggcctctcctctgccatgtgctactccgctttagtgactaaaaccaat
cgcatcgcacgcatcctagcgggcagcaagaagaagatctgcaccaggaagcccaggttc
atgagcgcctgggcccaggtgatcatcgcctcaattctgattagtgtgcagctaaccctg
gtggtaaccctgatcatcatggagccccccatgcccattctgtcctacccgagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtggtggcccctgtgggctacaac
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgcccgccaac
ttcaatgaggccaaatatatcgccttcaccatgtacaccacctgcatcatctggctggca
ttcgtgcccatttactttgggagcaactataagatcatcacgacctgctttgcagtgagc
ctgagtgtcacagtggccctggggtgcatgttcactcccaagatgtacatcattatcgcc
aagcctgagaggaacgtccgcagtgccttcaccacgtccgatgtggtccgcatgcacgtt
ggcgatggcaagctgccctgccgctccaacactttcctcaacattttccgaagaaagaaa
ccaggggcagggaataccaattctaatggcaagtctgtgtcatggtctgaaccaggtgga
agacaggtgcccaaggcacagcacatgtggcaccgtctctctgtgcacgtgaagaccaat
gagacggcctgcaaccaaacagccgtcatcaagcccctcactaaaagttaccagggctcc
ggcaagagcctgaccttttcagataccagcaccaagaccctttacaacgtggaggaggac
gatgcccagacggttggcttcagcgcccccagcagcccttccatggtggtgcaccgacgc
gtgccaaccgcggtgagcacaccgcctctgctgccgcacctggccgcagaggagaccccc
ctcttcctggccgagcccgccatccccaggggcttgcccccgcccctccagcagccgccg
ccgccggcgctgccgcagcagcagcagcagcagcagcagcagcagcagcagcagcagaaa
tccttaatggaccagctacagggagtggtcaacaatttcagcaccgggatccccgatttc
aacgcggtgctcgcagtcccggggggtccggggaatggggtgcggtccctgtacccgccc
ccggcgccccagcagcacctgcaaatgctcccgctgcagctgagcgccttgggggaggag
cccgcgtccccggctgccgaggacgaggatgaggatgacagcgagaggtttaagctcctc
caggagtacctgtacgagcgggaagggaacacggaggaagacgaactggaagaggacgag
gaggacccgcaggcggccagcaaacccaccccggaggattcgcctgctctgacgcctccg
tcgcctttccgcgactcggtggcctcgggcagctcggtgcccagctcccccgtgtccgag
tcggtgctctgcacccctcccaacgtgacctacgcctccgtcattctgagggactataag
caaagctcttccaccctgtag

DBGET integrated database retrieval system