KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514939
Entry
107514939         CDS       T06036                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00350  Tyrosine metabolism
ray01100  Metabolic pathways
ray04916  Melanogenesis
Module
ray_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107514939 (TYR)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107514939 (TYR)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     107514939 (TYR)
SSDB
Motif
Pfam: Tyrosinase DUF2062 Laminin_EGF DUF4381
Other DBs
NCBI-GeneID: 107514939
NCBI-ProteinID: XP_016008652
LinkDB
Position
Unknown
AA seq 533 aa
MILSVLYCLLWSFQTSTGHFPRACTSSKNLMEKECCPPWRGDGSPCGQLSGRGSCQNIVL
SNAPLGPQFPFTGVDDREAWPSVFYNRTCRCFGNFMGFDCGNCKFGFWGPQCTEKRLSVR
RNIFDLSIPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNNGSTPMFNDINIYDLFVWIH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AENCDICTDEYMGGRNPANPNLLSPASFFSSWQIICSQLEEYNSRQALCNGTPEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLAQYESGSMDKTANFSFRNTLEGFAHPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHTFVDSIFERWLRKHRPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSRDLGYDYSYLQDSEPDFFQDYIKPYLEQASRIWPWLIG
AAVVGSVLTAVLGGLTILLRRHRHRKRKQLSEEKQPLLMEKEDYHSLLDQSHL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgattctgtctgtgttgtactgcctactgtggagtttccagacctccactggccatttt
cctagagcctgtacatcctccaagaatctgatggagaaggaatgctgcccaccatggagg
ggtgatgggagtccctgtggccagctttcaggaagaggttcctgtcagaacattgttctg
tccaacgcaccacttggacctcaattcccctttacaggcgtggatgaccgagaggcttgg
ccctctgtcttttataacaggacctgccggtgctttggcaacttcatgggattcgactgt
ggaaattgcaagtttggcttttggggaccacagtgcacagagaagcgactctcagtgaga
agaaacatctttgatttgagtatcccagagaagaacaaatttcttgcctatctcactcta
gcgaagcataccaccagcccagactatgtcatccccacaggcacctatggccaaatgaat
aatggatcaacacccatgtttaatgacatcaacatttatgacctctttgtctggatacat
tattatgtgtcaagggacacactacttggaggatctgaaatctggagagacattgatttt
gctcatgaagcaccaggtttcctcccttggcatagacttttcttgttgctgtgggaacaa
gaaatccagaagctgacaggggatgagaacttcaccattccatactgggattggcgagat
gctgaaaactgtgacatttgcacagatgagtacatgggagggcgtaacccagcaaaccct
aacttactcagcccagcatccttcttctcctcttggcagatcatctgcagccagttggag
gagtacaacagccgtcaggctttatgcaatggaactccagagggaccattactacgtaat
cccggaaaccacgacaaagccaggaccccaaggctcccctcttcagctgatgtggaattt
tgcctgagtttggcccagtatgaatcgggttccatggataaaactgctaacttcagcttt
agaaatacactggaaggatttgctcatccacttactggaatagcagatgcctctcaaagc
agtatgcataatgccttgcacatctatatgaatggaacaatgtctcaggtacagggatct
gccaatgatcccatttttcttcttcaccatacatttgtggacagtatttttgagcggtgg
ctccgaaagcaccgacctcttcaagaagtttatccagaagccaatgcacccattggacat
aaccgggaatcctacatggttccttttatacctctctatagaaatggtgatttctttatt
tcatccagagacctgggctatgactatagctacctacaagattcagaaccggactttttt
caagattacattaagccctacttagaacaagcaagtcggatctggccatggctcattggg
gcagctgttgtggggtctgtcctcactgctgtgctgggagggcttactatcctgttacgt
cgtcatcgtcatcgcaagagaaagcagctctctgaagaaaaacagccactcctcatggaa
aaggaggattaccacagcttgttggatcagagccatttataa

DBGET integrated database retrieval system