KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514976
Entry
107514976         CDS       T06036                                 

Gene name
AVP
Definition
(RefSeq) vasopressin-neurophysin 2-copeptin
  KO
K05242  arginine vasopressin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107514976 (AVP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107514976 (AVP)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107514976 (AVP)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107514976 (AVP)
SSDB
Motif
Pfam: Hormone_5 Hormone_4
Other DBs
NCBI-GeneID: 107514976
NCBI-ProteinID: XP_016008745
LinkDB
Position
Unknown
AA seq 163 aa
MPNAMLPACFLSLLAFTAACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCG
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGA
GSHRRARASDRSNATQLDGQTEALLLRLVQLAGAPEPAAPGVY
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccaacgccatgctgcccgcctgcttcctcagcctgctggccttcactgctgcttgc
tacttccagaactgcccgaggggcggcaagagggccatgtctgacctggagctgagacag
tgcctcccctgcggccccgggggcaaaggacgctgcttcgggcccagcatctgctgcggg
gacgagctgggctgcttcgtgggcacagccgaggcgctgcgctgccaggaggagaactac
ctgccgtcgccctgccagtccggccagaagccgtgcgggagcggaggccgctgcgccgcc
gccggcatctgctgcaacgacgagagctgcgtgacggagcccgagtgccgggagggcgcc
ggctcccaccgccgcgcccgcgccagcgaccggagcaacgcgacccagctggacggccag
accgaagccctgctgctgcgcctggtgcagctggccggggcgcccgagcccgccgcgccc
ggcgtctactga

DBGET integrated database retrieval system