KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515029
Entry
107515029         CDS       T06036                                 

Gene name
OXT
Definition
(RefSeq) oxytocin-neurophysin 1
  KO
K05243  oxytocin-neurophysin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107515029 (OXT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515029 (OXT)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107515029 (OXT)
SSDB
Motif
Pfam: Hormone_5 Hormone_4
Other DBs
NCBI-GeneID: 107515029
NCBI-ProteinID: XP_016008875
LinkDB
Position
Unknown
AA seq 125 aa
MAGPSLACCLLGLLALTSACYIQNCPLGGKRAALDLDVRKCLPCGPGGKGRCFGPSICCG
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCRADPACDPEA
SFSQR
NT seq 378 nt   +upstreamnt  +downstreamnt
atggccggccccagtctcgcgtgctgcctgctcggccttctggcgctgacctccgcttgc
tacatccaaaactgccccctggggggcaagagggccgcgctggacctggatgtgcgcaag
tgcctcccctgcggccccgggggcaaagggcgctgcttcgggcccagcatctgctgcggg
gacgagctgggctgcttcgtgggcacagccgaggcgctgcgctgccaggaggagaactac
ctgccgtcgccctgccagtctggccagaagccgtgcgggagcggaggccgctgcgccgcc
gccggcatctgctgcagcccggacggctgccgcgcggaccccgcctgcgaccccgaggcc
tccttctcccagcgctga

DBGET integrated database retrieval system