KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515081
Entry
107515081         CDS       T06036                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04913  Ovarian steroidogenesis
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04934  Cushing syndrome
ray04976  Bile secretion
ray04979  Cholesterol metabolism
ray05145  Toxoplasmosis
ray05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107515081 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107515081 (LDLR)
   04925 Aldosterone synthesis and secretion
    107515081 (LDLR)
   04927 Cortisol synthesis and secretion
    107515081 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    107515081 (LDLR)
   04979 Cholesterol metabolism
    107515081 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107515081 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107515081 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107515081 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107515081 (LDLR)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    107515081 (LDLR)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF
Other DBs
NCBI-GeneID: 107515081
NCBI-ProteinID: XP_016008953
LinkDB
Position
Unknown
AA seq 886 aa
MLQMTGAPRAVAPRLREAGFSSRDAADRQRRPAARAGALLARAGSMRLCWSVALLLAAAG
AAVEDKCERNEFQCQDETCISYKWVCDGRADCQDGSDESQEMCMSVTCKLGDFSCGGHVN
RCIPQFWRCDGQMDCEDGSDEQGCPPKTCSQDEFRCQDGKCIFPSFVCDSDLDCLDGSDE
ASCPTSTCGPSSFQCNSSTCIPELWVCDDDPDCEDNSDEWPQHCGDRHVSAKGDNPCSAF
EFHCRSGECIHSGWRCDGDPDCKDKSDEENCTAATCGPDEFQCSDGPCIHGSQQCDREYD
CTDMSDELGCVNVTLCEGPTKFKCHSGECITMDKVCNSIRDCRDWSDEPLKECGTNECLD
NKGSCSHVCNDLKIGYECLCPEGFRLVDRLRCEDINECQDPDTCSQLCVNLEGSYKCECE
EGFQLDPFSKACKAMGTIAYLFFTNRHEVRRMTLDRSEYTSLLPNLKNVVALDMEVASNR
VYWSDLSQRKIYSTQIDRAPSFSYDTIISEDLQAPDGLAVDWIHSNIYWTDSILGTVSVA
NTRGAKRKTLLREKGSKPRAIVVDPIHGFMYWTDWGTPAKIKKGGLNGVDVYSLVTEDIQ
WPNGITLDLSSGRLYWVDSKLHSISSINVNGGNRKTVLEDKKKLAHPFSLAIFEDKVFWT
DIINEAIFSANRLTGSDINLMAENLLSPEDIVLFHNLTQPRGVNWCERTTLPNGGCQYLC
LPAPQINIHSPKFTCACPDGMLLAKDRRSCLIETEPLVTTWEPITVRSTAVGPKHMASLQ
SVTFPELPTAKTVATTHQALGNLVNKAEAKTSMSALYIVLPIVLLALLSFGTFLLWKNWR
LKSINSINFDNPVYQKTTEDEVHICRSQDGYTYPSRQMVSLEDDVA
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgttgcaaatgactggggctccgcgcgcggtcgccccccggctgcgcgaagccgggttt
tccagcagggacgctgcggaccgccaacggcggccagcggccagggccggcgcgttgctg
gcgagggctgggagcatgaggctgtgctggtccgtcgctctgctcctcgccgcggcgggt
gctgcagtggaagacaaatgtgagagaaatgagttccagtgtcaagatgagacgtgcatc
tcctataagtgggtttgcgacgggagagccgattgccaggatggctctgatgagtcccag
gagatgtgcatgtctgtcacttgcaagttgggggacttcagctgtggaggccatgtcaac
cgctgtattcctcagttctggagatgcgatggccagatggactgtgaggacggttcagac
gagcaaggctgtccccccaagacatgctcccaggacgagttccgctgccaggacgggaag
tgcatcttcccgagcttcgtctgcgactcggacctagactgtttggatggctccgatgag
gcctcctgccccacgtccacctgcggcccctccagcttccagtgcaacagctccacctgc
atccccgagctgtgggtctgcgacgatgaccccgactgcgaagataattcagacgaatgg
ccgcagcactgcggggaccgccacgtgtccgcaaaaggagacaacccttgctctgccttt
gagttccattgccgcagcggcgagtgcatccactccggctggcgctgcgacggcgaccct
gactgcaaagacaagtctgatgaggagaactgcactgcggccacgtgcgggcctgatgag
ttccagtgctcagatgggccctgtatccacggcagccagcagtgtgacagagagtatgac
tgtacagacatgagtgatgagcttggctgcgtcaatgtgactctgtgtgagggccccact
aagttcaagtgccacagcggcgaatgcatcaccatggacaaagtgtgcaactcgatccgg
gactgccgggactggtcggatgagcccctcaaggagtgtgggaccaatgagtgcctggac
aacaagggcagctgctctcatgtctgcaatgacctcaagatcggctacgagtgcttgtgt
cctgagggcttccggctggtggaccggctgagatgtgaagatatcaatgaatgtcaggac
cctgacacctgcagccagctctgcgtgaacctcgagggtagctacaagtgcgagtgtgag
gagggcttccagttggaccccttctccaaggcctgcaaggccatgggcaccatcgcctac
ctctttttcacaaaccgccatgaggtgaggaggatgacgctggatcgcagtgaatacacc
agcctccttccgaacctgaagaatgtggtcgccctggacatggaggtggccagcaacaga
gtctattggtccgacctgtcccagaggaagatctacagcacccagatcgacagggcaccc
agcttctcctatgacaccatcatcagtgaggacctccaggcccccgacgggctggcagtg
gactggatccacagcaacatatactggaccgactccatcctgggcaccgtctccgtggcc
aataccaggggtgcaaagagaaagacgctcctcagggagaaaggatccaagccgagggct
atcgtggtggatcccattcatggcttcatgtactggacagactggggaactcctgccaag
atcaagaaggggggcctaaatggcgtggatgtttactcactggtgacagaggacatccag
tggcccaatggcatcactctggatctttccagtggccgcctctactgggttgattccaag
ctccactccatctccagcattaacgtcaatggtgggaaccggaagacagttttggaggac
aagaaaaagctggcacaccccttctcgttggccatctttgaggataaagtattttggaca
gatatcatcaacgaagccattttcagtgccaaccgcctcactgggtccgacattaatttg
atggcagaaaacctgttgtccccggaggacatagtccttttccacaacctcacgcagcca
cgaggggtaaactggtgtgagaggaccaccctccccaacggtggctgccagtacctgtgt
ctcccagccccgcagatcaacatccactcacccaagttcacttgtgcctgccctgacggc
atgctgctggccaaggacaggagaagctgtctcatagaaaccgaacccctggtgaccacc
tgggagcccatcacagtccgctcgacagctgtagggccgaagcacatggccagcctgcag
tctgtgacctttcctgagctccccactgccaagacagtggccacgacccaccaagccctg
ggcaaccttgttaacaaagcagaagcgaagacgagcatgagcgcgctatacatcgtcctc
cccattgtgctgcttgccctcctgagctttgggaccttcctcctctggaagaactggagg
ctgaagagcatcaacagcatcaactttgacaaccccgtgtaccagaagaccacagaggac
gaggtccacatctgccgcagccaggacggctacacctatccctctagacagatggtcagc
ctggaggatgacgtggcatga

DBGET integrated database retrieval system