KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515099
Entry
107515099         CDS       T06036                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1 isoform X1
  KO
K06490  intercellular adhesion molecule 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04064  NF-kappa B signaling pathway
ray04514  Cell adhesion molecules
ray04650  Natural killer cell mediated cytotoxicity
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05143  African trypanosomiasis
ray05144  Malaria
ray05150  Staphylococcus aureus infection
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05323  Rheumatoid arthritis
ray05416  Viral myocarditis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107515099 (ICAM1)
   04668 TNF signaling pathway
    107515099 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107515099 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107515099 (ICAM1)
   04670 Leukocyte transendothelial migration
    107515099 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    107515099 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107515099 (ICAM1)
   05416 Viral myocarditis
    107515099 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515099 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107515099 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515099 (ICAM1)
   05164 Influenza A
    107515099 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515099 (ICAM1)
   05169 Epstein-Barr virus infection
    107515099 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    107515099 (ICAM1)
   05143 African trypanosomiasis
    107515099 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107515099 (ICAM1)
   04090 CD molecules [BR:ray04090]
    107515099 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107515099 (ICAM1)
   04091 Lectins [BR:ray04091]
    107515099 (ICAM1)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107515099 (ICAM1)
CD molecules [BR:ray04090]
 Proteins
  107515099 (ICAM1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Hyaluronan
  Cell surface receptors
   107515099 (ICAM1)
Lectins [BR:ray04091]
 I-type lectins (Siglecs)
  107515099 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 C2-set_2 I-set ig Apq12 DUF4396 PMT_4TMC
Other DBs
NCBI-GeneID: 107515099
NCBI-ProteinID: XP_016009019
LinkDB
Position
Unknown
AA seq 576 aa
MPEPSFRFGGEDARFPGNQRRPSLGSAGIKDQSASGTQSVLRPGVLLTSVAMAPDATQLT
LPAILTLLGVLLPGPGGAQISVQPPKAIIPRGGSVQVNCSDSCDLLGLETQSIKREVAHG
NNWKTYELSNIQEDGSPICFSNCHKQQTKVATSITVYWFPERVELESLPHWQPVGKNLTL
RCQVEGGAPRPHLSVVLLRGEEELSRQMKVNLTEVTATVLAGRDDHGANFSCRTELDLRS
EGLGLFQNISVPRQLRTFVLPVTNPHLATPLIMEVGTRQLVNCTLVGLFPASEAQVQLVL
GDQKLEPTIKYNDDFLWASAWVEAKPKEEGNHQLTCAVTLGNESRMSHQTVTIYSFPPPS
LNLSQLEVSELTVVSVECKAHAGAVVMLSGAPAGPPAPSAQFQLNVTAEDNGHSFLCSAV
LEVAGEVLYKNETLKLSVLYGPQLNEKDCPGNWTWQEGSQQTLRCQASGNPTPKLDCRQN
GTGSLLPIGDLRPVKREIAGTYVCRAKSSRGEVIRQVIVNVIYHDNNMIIIMLVTAAFIV
SVVLTGAYLYNRQRKIREYKLQKAQEAAAMKLNTPP
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgcccgagccctcctttcgtttcggaggagaagacgcaaggtttccgggaaatcagcgc
cgcccctcgctcgggtcagccggtataaaggaccagagtgcttctggcacccagtccgtg
ctgcgccctggggtccttcttacctcggtcgctatggctcctgacgccacccagctcaca
ctgcccgcgatcctgaccctgctcggggttctgctcccagggcctggaggtgcccaaata
tcagtgcaacccccaaaagccatcataccacgaggaggctctgtccaggtgaactgcagt
gactcctgtgacctactgggtctggagactcagtcgattaagagggaagtggcccatggg
aacaactggaagacctatgaacttagtaatatacaagaagacggatctccaatatgcttc
tcaaactgtcacaaacaacagacgaaagttgcaacatccatcactgtgtactggttccca
gagcgtgtggagctggaatccctaccccactggcagccggtgggcaagaacctcaccctg
cgctgccaggtagagggaggagcgccccggccccatctctccgtggtcctgctccgtggg
gaggaggagctgagtcggcagatgaaagtcaacctcactgaggtcacggccacggtgctg
gcaggcagagacgaccatggtgccaatttctcttgtcgcacggaactggaccttcggtct
gaagggctgggactattccagaacatttcagtccccaggcaactccgaaccttcgtcctg
ccagtgaccaacccgcaccttgccaccccccttatcatggaagtgggcacgcggcagttg
gtgaactgcaccctggttgggctgttcccagcctcagaggcccaggtccagctggtactg
ggggaccagaagctggaacccacaatcaagtacaacgatgacttcctctgggctagtgcc
tgggtcgaggcaaaaccaaaagaggagggcaaccaccagctgacatgtgccgtcaccctg
ggaaacgagagccggatgtcgcatcagactgtgaccatctacagcttccctcctcccagc
ctgaaccttagccagcttgaggtttcggagttgactgtggtgagcgtggagtgcaaggcc
catgctggagccgtggtgatgctgagtggggccccagccgggcctccagccccaagtgcc
caatttcagctgaatgttacagccgaggacaatggtcacagcttcttgtgttctgctgtc
ctggaagtggccggggaggtgctgtacaagaacgagaccctgaagctcagtgttctgtat
ggtccccaactaaatgagaaggattgcccaggaaattggacgtggcaggaaggctcccag
cagaccctgaggtgccaggcctcggggaacccaacccctaaactggactgtcgccagaat
ggaactgggtctttgctgcccatcggggacctgcgccctgtcaagagggagattgcgggc
acctatgtgtgtcgggccaagagcagtcgtggtgaggtcatccgtcaagtgatcgtgaac
gtgatctaccacgataataacatgatcatcatcatgctggtgacagctgcattcatcgtg
agtgttgtgctcacaggcgcttacctctataaccgccagcggaagatccgggaatacaag
ctacagaaggcccaggaggcggccgccatgaagctgaacactccaccctga

DBGET integrated database retrieval system