KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515126
Entry
107515126         CDS       T06036                                 

Gene name
PLN
Definition
(RefSeq) cardiac phospholamban
  KO
K05852  phospholamban
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04919  Thyroid hormone signaling pathway
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515126 (PLN)
   04024 cAMP signaling pathway
    107515126 (PLN)
   04022 cGMP-PKG signaling pathway
    107515126 (PLN)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107515126 (PLN)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107515126 (PLN)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107515126 (PLN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107515126 (PLN)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107515126 (PLN)
SSDB
Motif
Pfam: Phospholamban Sarcolipin Myc_target_1
Other DBs
NCBI-GeneID: 107515126
NCBI-ProteinID: XP_016009102
LinkDB
Position
Unknown
AA seq 52 aa
MEKVQYLTRSAIRRASNIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt   +upstreamnt  +downstreamnt
atggagaaagtccaatacctcactcgctctgctataagaagagcttcaaacattgaaatg
cctcaacaagcacgtcagaatctccagaacctatttatcaacttctgtctcatcttaata
tgtctcttgttgatctgcatcatcgtgatgcttctctga

DBGET integrated database retrieval system