KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515241
Entry
107515241         CDS       T06036                                 

Gene name
ORAI1
Definition
(RefSeq) calcium release-activated calcium channel protein 1 isoform X1
  KO
K16056  calcium release-activated calcium channel protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04611  Platelet activation
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04934  Cushing syndrome
ray05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515241 (ORAI1)
   04024 cAMP signaling pathway
    107515241 (ORAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107515241 (ORAI1)
  09152 Endocrine system
   04924 Renin secretion
    107515241 (ORAI1)
   04925 Aldosterone synthesis and secretion
    107515241 (ORAI1)
   04927 Cortisol synthesis and secretion
    107515241 (ORAI1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    107515241 (ORAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107515241 (ORAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515241 (ORAI1)
Ion channels [BR:ray04040]
 Other channels
  Calcium channel, calcium release-activated (Orai)
   107515241 (ORAI1)
SSDB
Motif
Pfam: Orai-1 m04gp34like YrhC
Other DBs
NCBI-GeneID: 107515241
NCBI-ProteinID: XP_016009315
LinkDB
Position
Unknown
AA seq 292 aa
MHPEPAPPPSSSSPELPLSGSRRSRRRSGDGEPPGSPPPPAVTYPDWIGQSYSKVMSLNE
HSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDAEHDYPPGLLIAFSACTT
VLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIGTLLFL
AEVVLLCWVKFLPLKKQPGQPRPTSKPPSANVNNGSAGGITPGQAAAIASTTIMVPFGLV
FIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHYA
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcatccggagcccgccccgcccccgagcagcagcagcccggagcttcccctcagcggc
agccgccggagccgccgccggagcggggacggggagcccccagggtcgccgccaccgccc
gccgtcacttacccggactggatcggccagagttactccaaggtgatgagcctcaacgag
cactcgatgcaggcgctgtcctggcgcaagctctacttgagccgcgccaagctcaaagcc
tccagccgaacctcggctctgctctccggcttcgccatggtggcgatggtggaggtgcag
ctggacgccgagcatgactacccgccggggctgctcatcgccttcagcgcctgcacgacg
gtgctggtggcggtgcacctgttcgcgctcatgatcagcacgtgcatcctgcccaacatc
gaggccgtgagcaacgtgcacaacctcaactcggtcaaggagtcgccccacgagcgcatg
caccgccacatcgagctcgcctgggccttctccaccgtcatcggcacgttgcttttcctg
gctgaggtggtgctgctctgctgggtcaagttcctgcctctgaagaagcagccgggccag
ccgcggcctaccagcaagcccccgtccgcaaacgtcaacaacggcagcgcgggtggcatc
accccgggccaggccgctgccatcgcctccaccaccatcatggtcccctttggcctggtc
ttcatcgtctttgccgtccacttctaccgctcactggtcagccataagacggaccgacag
ttccaggagctcaacgagctggccgagttcgcccgcttgcaggaccagctggaccacaga
ggggaccaccccctgacgcccggcagccactacgcctaa

DBGET integrated database retrieval system