KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515269
Entry
107515269         CDS       T06036                                 

Gene name
GJA1
Definition
(RefSeq) gap junction alpha-1 protein
  KO
K07372  gap junction alpha-1 protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04540  Gap junction
ray05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107515269 (GJA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107515269 (GJA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107515269 (GJA1)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107515269 (GJA1)
SSDB
Motif
Pfam: Connexin Connexin43 Connexin40_C 7tm_1 Ammonium_transp
Other DBs
NCBI-GeneID: 107515269
NCBI-ProteinID: XP_016009372
LinkDB
Position
Unknown
AA seq 382 aa
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKREEELKVAQTDG
ANVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFT
LSAVYTCKREPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGKSDPYHTTTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtgactggagtgccttaggcaagctccttgacaaggttcaagcatattccactgct
ggagggaaggtgtggctctcagtgcttttcattttccgaatcctgctgctggggacagct
gttgagtcagcctggggtgatgagcagtctgcctttcgttgtaacactcaacaacctggt
tgtgaaaacgtctgctatgacaagtccttcccaatctctcatgtgcgcttctgggtcctg
cagatcatctttgtgtctgttcccacactcttgtacctggctcatgtgttctacgtgatg
cggaaagaagagaaactgaacaagagagaggaggaactgaaagttgcccaaaccgatggt
gcgaatgtggagatgcacttgaagcagatcgaaataaagaagtttaagtatggtattgaa
gagcacggcaaggtgaaaatgcgagggggcttgctgcgaacctacatcatcagcatcctc
ttcaagtctgtctttgaggtggccttcttgctaatccagtggtacatctatggattcacc
ctgagtgccgtttacacttgcaaaagagagccatgcccacatcaggtggactgcttcctc
tctcgtcccacagagaaaaccatcttcatcatctttatgctggtagtatccttggtgtct
cttgccttgaacatcatcgaactcttctatgtcttcttcaagggtgtaaaggatcgtgtg
aaggggaagagcgatccctaccacactaccacgggcccactgagtccctccaaagactgt
ggatctccaaaatatgcttatttcaatggctgctcctcaccaacggctcccctctcgccc
atgtctcctcctgggtacaagctggttactggagacagaaacaattcttcgtgtcgcaat
tacaacaaacaagcaagtgaacaaaactgggctaattatagtgcagagcaaaatcgaatg
gggcaggcaggaagcaccatctctaactcccacgcacagccttttgacttccctgatgac
aaccagaattctaaaaaactagctgctggacacgaactacaacctctagccattgtggac
cagcggccttccagcagagccagcagtcgcgccagtagccgacctcggcctgatgacctg
gagatctag

DBGET integrated database retrieval system