KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515312
Entry
107515312         CDS       T06036                                 

Gene name
AREG
Definition
(RefSeq) LOW QUALITY PROTEIN: amphiregulin
  KO
K09782  amphiregulin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515312 (AREG)
   04012 ErbB signaling pathway
    107515312 (AREG)
   04390 Hippo signaling pathway
    107515312 (AREG)
   04151 PI3K-Akt signaling pathway
    107515312 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    107515312 (AREG)
Chaperones and folding catalysts [BR:ray03110]
 Intramolecular chaperones
  Others
   107515312 (AREG)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107515312 (AREG)
SSDB
Motif
Pfam: FtsL EGF
Other DBs
NCBI-GeneID: 107515312
NCBI-ProteinID: XP_016009488
LinkDB
Position
Unknown
AA seq 251 aa
MRAPPLPLAPVVLSLLIIGSAHYAAALDVNDTFSGKEEPFSGDYGADGFEVTSRSEMSSG
SEISPVSEMPSTSKLSSGIDYDYEEEYDNEPQISGYIVDDSVRVEQVVKPKKNKTESXSD
KSKRKKKGSKNGKNRRNRKKKNPCDAEFQNFCIHGDCKYIDHLKTTSCLCHQDYFGERCG
EKSMKTHSMVDGDLSKITLAAIAAFISAVSFTAIAVVITIQLRKRYFRDYEGEAEERKKL
RQENGNAQAIA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgagagccccgccgctgccgctggcgcccgtggtgctgtcgctcctgatcatcggctca
gcccattatgctgctgctttggacgttaatgacaccttctctgggaaagaggaaccattt
tctggggactatggtgctgatggatttgaagttacctcaagaagtgagatgtcctcagga
agtgagatttcccctgtgagtgagatgccttctactagcaaactgtcctcagggatcgac
tatgactatgaagaagagtatgataatgaaccacaaatatctggctatattgtagatgat
tcagtcagagttgaacaggtagttaaaccgaagaaaaacaaaacagaaagtnnttcagat
aagtccaaaagaaagaaaaaaggaagcaaaaatggaaaaaatagacgaaacagaaagaag
aaaaatccatgcgatgctgagtttcaaaatttctgcattcacggagattgcaaatatata
gaccatctgaaaacaacatcatgcctctgccatcaggattactttggtgaacggtgtgga
gaaaagtccatgaagactcacagcatggtcgatggtgatttatcgaaaattacgttagca
gccatagctgccttcatctcagctgtgagcttcacagctattgctgttgttattacaatt
cagcttcgaaaacgatacttcagggactatgaaggagaagctgaagaacgaaagaaactt
cgacaagaaaatggaaatgcacaagccatagcataa

DBGET integrated database retrieval system