KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515317
Entry
107515317         CDS       T06036                                 

Definition
(RefSeq) C-X-C motif chemokine 15-like
  KO
K10030  interleukin 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04072  Phospholipase D signaling pathway
ray04218  Cellular senescence
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05132  Salmonella infection
ray05133  Pertussis
ray05134  Legionellosis
ray05135  Yersinia infection
ray05142  Chagas disease
ray05144  Malaria
ray05146  Amoebiasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05219  Bladder cancer
ray05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107515317
   04072 Phospholipase D signaling pathway
    107515317
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107515317
   04061 Viral protein interaction with cytokine and cytokine receptor
    107515317
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107515317
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107515317
   04621 NOD-like receptor signaling pathway
    107515317
   04622 RIG-I-like receptor signaling pathway
    107515317
   04657 IL-17 signaling pathway
    107515317
   04062 Chemokine signaling pathway
    107515317
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515317
   05202 Transcriptional misregulation in cancer
    107515317
  09162 Cancer: specific types
   05219 Bladder cancer
    107515317
  09163 Immune disease
   05323 Rheumatoid arthritis
    107515317
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107515317
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515317
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107515317
   05135 Yersinia infection
    107515317
   05133 Pertussis
    107515317
   05134 Legionellosis
    107515317
  09172 Infectious disease: viral
   05161 Hepatitis B
    107515317
   05171 Coronavirus disease - COVID-19
    107515317
   05164 Influenza A
    107515317
   05163 Human cytomegalovirus infection
    107515317
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515317
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107515317
   05144 Malaria
    107515317
   05142 Chagas disease
    107515317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107515317
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107515317
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Chemokines
   107515317
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Chemokines
   107515317
SSDB
Motif
Pfam: IL8 NucS
Other DBs
NCBI-GeneID: 107515317
NCBI-ProteinID: XP_016009495
LinkDB
Position
Unknown
AA seq 94 aa
MAAGSSRTLLLAALVLGIFDDPCESQELRCQCVQTYSNFIHPIFFENIQLIPEGPHCRRK
EVIVTLRNGKLVCLDPEAKWVMTIIKKIKDSAAH
NT seq 285 nt   +upstreamnt  +downstreamnt
atggctgctgggagctcacgaacgctcctgctggctgcccttgtcctgggcatcttcgat
gatccctgtgagagccaagagttacgatgtcagtgtgttcagacatattctaactttatt
catcccatattctttgaaaatattcagttgatacctgaaggtccccactgcagaagaaaa
gaagttatagtcacattaagaaatgggaaattagtttgtttggatcctgaggcgaaatgg
gtgatgactattatcaaaaagattaaggacagtgctgctcactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515319
Entry
107515319         CDS       T06036                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04072  Phospholipase D signaling pathway
ray04218  Cellular senescence
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05132  Salmonella infection
ray05133  Pertussis
ray05134  Legionellosis
ray05135  Yersinia infection
ray05142  Chagas disease
ray05144  Malaria
ray05146  Amoebiasis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05219  Bladder cancer
ray05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107515319 (CXCL8)
   04072 Phospholipase D signaling pathway
    107515319 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107515319 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107515319 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107515319 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107515319 (CXCL8)
   04621 NOD-like receptor signaling pathway
    107515319 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    107515319 (CXCL8)
   04657 IL-17 signaling pathway
    107515319 (CXCL8)
   04062 Chemokine signaling pathway
    107515319 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515319 (CXCL8)
   05202 Transcriptional misregulation in cancer
    107515319 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    107515319 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107515319 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107515319 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515319 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107515319 (CXCL8)
   05135 Yersinia infection
    107515319 (CXCL8)
   05133 Pertussis
    107515319 (CXCL8)
   05134 Legionellosis
    107515319 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107515319 (CXCL8)
   05171 Coronavirus disease - COVID-19
    107515319 (CXCL8)
   05164 Influenza A
    107515319 (CXCL8)
   05163 Human cytomegalovirus infection
    107515319 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515319 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107515319 (CXCL8)
   05144 Malaria
    107515319 (CXCL8)
   05142 Chagas disease
    107515319 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107515319 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107515319 (CXCL8)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Chemokines
   107515319 (CXCL8)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Chemokines
   107515319 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107515319
NCBI-ProteinID: XP_016009497
LinkDB
Position
Unknown
AA seq 101 aa
MTSKLAVAFLAAFVLSAALCEAAVLSRISTELRCQCIKTHSAPFHPKFIKELRVIESGPH
CANSEIIVKLVKGDEVCLNPKEKWVQKVVQVFLKRAEKQDS
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctttcttggcagctttcgtgctttctgcagctctgtgt
gaagctgcagttctgtcgagaataagtacagaacttcgatgccagtgcataaaaacacat
tctgcaccttttcaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgcaaattcggaaatcattgtaaagctcgtcaaaggagatgaggtctgcctgaacccc
aaagaaaagtgggtgcagaaggttgtgcaagtatttttgaagagagctgagaagcaagat
tcatga

DBGET integrated database retrieval system