KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515327
Entry
107515327         CDS       T06036                                 

Gene name
BTC
Definition
(RefSeq) probetacellulin
  KO
K09783  betacellulin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107515327 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107515327 (BTC)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107515327 (BTC)
SSDB
Motif
Pfam: EGF Laminin_EGF Sigma_reg_N Shisa
Other DBs
NCBI-GeneID: 107515327
NCBI-ProteinID: XP_016009513
LinkDB
Position
Unknown
AA seq 175 aa
MNRVFRIEEIFKFSCLLWFPFELQGPVILHCVVADGNSTRSSENDLLCRDAGENCAATTT
QSKWNDYFSQCPPKYEHYCLNGRCRFVVALQTPSCLCDEGYAGARCERVDFFYLRGDTGQ
ILVICLTAVMVTLIILVISVCTCCHPLRRKKKEEMANLGKDITPVNEDIQETSIA
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaacagagtatttcgcattgaggaaatttttaagttttcatgtttgttgtggttccct
tttgaacttcaaggtccagtgatcctccattgtgttgtggcagatgggaattcaaccaga
agttctgaaaatgaccttctctgcagagatgctggagaaaactgtgcagctaccactaca
caatcaaagtggaatgactacttctctcagtgccccccaaaatacgagcattactgcctc
aatgggagatgtcgcttcgtggtcgccttgcagacaccctcctgcctctgtgacgagggc
tacgctggagcaaggtgtgagagagttgactttttttacctgcgaggagatacaggacag
attctggtgatttgtttgacagccgttatggtgacgttgatcattttggtgattagtgtg
tgcacatgttgtcatccccttcgaaggaaaaagaaagaagaaatggcaaatcttggtaaa
gatataactcctgtaaatgaagatattcaagagaccagtattgcttaa

DBGET integrated database retrieval system