KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515330
Entry
107515330         CDS       T06036                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04151  PI3K-Akt signaling pathway
ray05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515330 (EREG)
   04012 ErbB signaling pathway
    107515330 (EREG)
   04151 PI3K-Akt signaling pathway
    107515330 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    107515330 (EREG)
SSDB
Motif
Pfam: DUF3149 DcuC EGF DUF2663 DUF5305 Insulin_TMD DUF2207
Other DBs
NCBI-GeneID: 107515330
NCBI-ProteinID: XP_016009515
LinkDB
Position
Unknown
AA seq 274 aa
MSNLVQAKAMPHLDSSRACYQFFGPLLCGANLKNATFTVSQRMSCQLLGRDQCYGTFGEL
NMCLDGVRGTCLRATRQALRRAPAGRLRSFPAAAAQPQRPRAPPKVSAAGRMEPHLARQG
PVLLLCLGFHLLQVVISATVIPSCIPGESEDNCTALVQTENNPRMAPVVITKCSSDHNGY
CLHGQCIYLVGISENYCRCELGYAGVRCEHFFLTVQQPLSEEYVVLSVILIVLFLLIVAG
FIYYFCRWYKNKKSKESKKEYEKVTSEDLALPQV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgagcaaccttgtgcaagccaaagcaatgccacatttggattcttcacgtgcttgctac
cagttttttggaccactgctctgtggagctaatctcaaaaatgctacttttacggtgtct
cagaggatgtcatgtcaactattaggaagagatcagtgttatggcaccttcggtgaacta
aacatgtgcctggatggtgtcagagggacgtgcctacgtgcgacccgccaggctctccgc
cgcgctcccgccggacgcttgcgctcgttccccgcagccgccgcccagccgcagcgcccg
cgggctccgccgaaggtctccgctgcggggaggatggagccgcacctcgcccgccagggg
cccgtcctgctgctctgcctgggtttccatcttctccaagtagttatcagtgcaactgtg
attccttcatgtatcccaggagaatctgaagataactgcacagctttagttcagacagaa
aacaacccacgtatggctccagtggtgataacaaagtgtagctctgaccataatggctac
tgtttgcatggacagtgcatctacctggtgggcataagtgaaaattactgcagatgtgaa
ttaggttatgctggagtccgatgtgagcacttcttcttgactgtccaacagcccttgagt
gaagaatacgtggttttgtctgtgattcttattgtcttatttcttctcatagtcgctggt
ttcatatactatttctgcagatggtacaaaaataaaaaaagtaaagaatcaaagaaggaa
tatgaaaaggtgacttcagaggatctggcgttgccacaagtctga

DBGET integrated database retrieval system