KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515361
Entry
107515361         CDS       T06036                                 

Gene name
UCP1
Definition
(RefSeq) mitochondrial brown fat uncoupling protein 1 isoform X1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03320  PPAR signaling pathway
ray04371  Apelin signaling pathway
ray04714  Thermogenesis
ray05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107515361 (UCP1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107515361 (UCP1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107515361 (UCP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107515361 (UCP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107515361 (UCP1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   107515361 (UCP1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 107515361
NCBI-ProteinID: XP_016009570
LinkDB
Position
Unknown
AA seq 306 aa
MMGPTTSDVHPTMAVKLFSAGVAACVADAITFPLDTAKVRLQIQGESKTSSAIRYKGVLG
TVTTLARTEGPMKLYGGLPAGLQRQISSASLRIGLYDTFQEFFTTGRESSLGSKISAGLT
TGAVAVFIGQPTEVVKVRLQAQSHLHGLKPRYTGTYNAYRIIATTEGLTGLWKGTSLNLA
RSIIINCTELVTYDLMKEALVKNKVLADGVPCHAVAAVIAGFCTTVLSSPVDVVKTRFIN
SPPGQYTSVPNCAMTMLAKEGPSAFFKGLVPAFLRLGSWNVIMFVCFEQLKRELMRSRQT
AVDCAT
NT seq 921 nt   +upstreamnt  +downstreamnt
atgatgggccccacgacctcggacgtgcacccgaccatggcggtcaagctcttctccgcc
ggagtggcggcctgcgtggcggatgcgatcaccttcccgctggacacagccaaagtccgg
ctccagatccaaggtgaaagcaagacctctagtgccattaggtataaaggcgtcctggga
acagtcaccactctggccagaacagaagggcccatgaagctctacggcgggctgcccgct
ggcctccagagacaaataagctccgcctccctccggatcgggctctacgacaccttccag
gaattcttcaccacggggagagaaagtagtttaggaagcaagatctcagctggcctgacg
accggggcagtggcagtattcatcgggcagcccacggaggtcgtgaaggtcagacttcaa
gcacagagccatctgcatggcctcaaacctcgctacactgggacttacaatgcttacaga
attatagcaactacggaaggcttgacgggtctttggaaagggacttctctcaatctggcc
agaagtatcatcatcaattgtacagagctagtaacgtacgacctaatgaaggaagccctc
gtgaaaaacaaagtactagcagacggtgtgccctgccacgccgtggcggccgtcatcgcc
ggattttgcacgaccgttctgtcctctccagtggacgtggtgaaaacccgattcatcaac
tctccgccaggacagtacacgagtgtgcccaactgcgcaatgacaatgctcgctaaggaa
ggaccgtcggcgtttttcaaaggattagtacctgccttcctgcgactcggatcctggaac
gtcatcatgtttgtgtgctttgaacagctgaagagagagctgatgaggtcacggcagacc
gccgtggactgtgccacatag

DBGET integrated database retrieval system