KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515376
Entry
107515376         CDS       T06036                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00250  Alanine, aspartate and glutamate metabolism
ray00280  Valine, leucine and isoleucine degradation
ray00410  beta-Alanine metabolism
ray00640  Propanoate metabolism
ray00650  Butanoate metabolism
ray01100  Metabolic pathways
ray04727  GABAergic synapse
Module
ray_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107515376 (ABAT)
   00650 Butanoate metabolism
    107515376 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107515376 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    107515376 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107515376 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107515376 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ray01007]
    107515376 (ABAT)
Enzymes [BR:ray01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     107515376 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     107515376 (ABAT)
Amino acid related enzymes [BR:ray01007]
 Aminotransferase (transaminase)
  Class III
   107515376 (ABAT)
SSDB
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Other DBs
NCBI-GeneID: 107515376
NCBI-ProteinID: XP_016009592
LinkDB
Position
Unknown
AA seq 500 aa
MASMLLTQRLACSFQRNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALMKLVQQPQ
NVSAFINRPALGILPPENFVEKLRESLISVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGKTGFSKEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLSNAAHAGKALVTGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagcggctggcctgcagcttccagcgcaactaccgcctg
cttgtgcccggatccagacatattagtcaggctgcagccaaagtcgacgttgaatttgat
tatgacgggcctctgatgaagacggaagtcccagggcccagatctcgggagttaatgaaa
cagctgaatataattcagaatgcagaagctgtgcatttcttctgcaattatgaagagagc
cgaggcaattacctggtcgatgtggatggcaaccggatgttggacctttattctcagatc
tcctctgtccccattggttacagccatcctgctcttatgaaactcgtccaacagcctcaa
aatgtgagcgcattcatcaacagacctgccttgggtatcctgcctccagagaactttgtg
gagaagctgcgggagtccctgatctcggtggctcccaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaacgccttcaagaccatcttcatgtggtaccgg
agcaaggaaaggggtaaaacaggtttctccaaagaggagctggagacgtgcatgatcaac
caggcccccggctgccccgactacagcatcctctccttcatgggcgcgttccacgggagg
accatgggttgcttagcgaccacgcactccaaagctatccacaagatcgacatcccttcc
ttcgactggcctatcgccccgttcccccggctgaagtaccctctggaagagttcgtgaag
gagaaccaacaggaagaggcccgctgcctggaagaggtggaagatctgatcgtgaaatat
cggaaaaagaagaagacggtggctgggatcatcgtggagcccatccagtctgagggtggg
gacaaccacgcctctgacgacttcttccggaagctgagagacatctccaggaagcacggc
tgtgccttcttggtggatgaggtccagacgggagggggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgaccctgcggacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcccaacgctccttaccggatcttcaac
acctggctgggggacccatccaagaacctgctgctggccgaggtcatcaacgtcatcaag
cgagaggacctgctgagtaatgcagcccacgccgggaaggccctggtcacggggctgctg
gacctccaggcccggtacccccagttcatcagcagggtgagaggacgaggcaccttctgc
tccttcgacactccagatgaatccatacggaataaactcattttaatagccagaaacaaa
ggtgtggtgttggggggctgcggtgacaaatccattcgtttccgtcccactctggtcttc
agggatcaccacgcacacctgttcctcaatattttcagcgacatcttagccgacttcaag
taa

DBGET integrated database retrieval system