KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515439
Entry
107515439         CDS       T06036                                 

Gene name
TNNI3
Definition
(RefSeq) troponin I, cardiac muscle
  KO
K12044  troponin I, cardiac muscle
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107515439 (TNNI3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107515439 (TNNI3)
   04261 Adrenergic signaling in cardiomyocytes
    107515439 (TNNI3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107515439 (TNNI3)
   05414 Dilated cardiomyopathy
    107515439 (TNNI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107515439 (TNNI3)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107515439 (TNNI3)
SSDB
Motif
Pfam: Troponin Troponin-I_N Tup_N Hamartin DUF919 DUF3738 CorA
Other DBs
NCBI-GeneID: 107515439
NCBI-ProteinID: XP_016009749
LinkDB
Position
Unknown
AA seq 211 aa
MADESSDAAGDSRPASAPVRRRSSVNYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQ
ELEREAEERRGEKGRALSTRCQPLELAGLSFEELQDLCRQLHARVDKVDEERYDVEAKVT
KNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKE
DTEKENREVGDWRKNIDALSGMEGRKKKFEG
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcggatgagagcagcgatgcggccggggactcgcgccccgcgtctgctccggtccgc
cgccgctcctctgtcaactaccgcgcctatgccaccgagcctcatgccaagaaaaagtct
aagatctccgcctcgagaaaactgcagctgaagaccctgatgctgcagatagcaaagcag
gagctggagcgggaggcggaagagcggcgtggagagaaggggcgcgctctgagcacgcgg
tgccagcctctggagttggctgggctgagcttcgaggagctgcaggacttgtgccgacag
ctccacgcccgtgtggacaaggtggatgaggagagatatgatgtggaggcaaaagtcacc
aagaacatcacggagattgcagatctgacccagaaaatctttgatcttcggggcaagttc
aagcggcccaccctgcggagggtgcggatctctgcagatgccatgatgcaggcactgctg
ggaaccagggctaaggagtccttagacctgcgggcccacctcaagcaggtgaagaaggag
gacacggagaaggaaaaccgggaggtgggagactggcggaagaacatcgacgcactgagt
ggaatggagggccgcaagaaaaagtttgagggctga

DBGET integrated database retrieval system