KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515459
Entry
107515459         CDS       T06036                                 

Gene name
PTK2B
Definition
(RefSeq) protein-tyrosine kinase 2-beta isoform X1
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04670  Leukocyte transendothelial migration
ray04912  GnRH signaling pathway
ray05135  Yersinia infection
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515459 (PTK2B)
   04072 Phospholipase D signaling pathway
    107515459 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107515459 (PTK2B)
   04670 Leukocyte transendothelial migration
    107515459 (PTK2B)
   04062 Chemokine signaling pathway
    107515459 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107515459 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107515459 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107515459 (PTK2B)
   05161 Hepatitis B
    107515459 (PTK2B)
   05163 Human cytomegalovirus infection
    107515459 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515459 (PTK2B)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107515459 (PTK2B)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  FAK family
   107515459 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 107515459
NCBI-ProteinID: XP_016009790
LinkDB
Position
Unknown
AA seq 1008 aa
MSGVSEPLSRVKVGTLRRPEGPPEPMVVPVDVEKEDVRILKVCFYNNSFNPGKNFKLVKC
TVQTEIREVIASILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECL
HVEAEWRYDLQIRYLPEDFMESLKKDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCL
ELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASL
REEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAE
FKQIKSIRCLLLEEDQAALQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKGS
LIIHPKKDGEKRNSLPQIPVLNVEVQRPYLSESCSIESDIYAEIPDETLRRPGGPQYGIA
REDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNL
DHPHIVKLIGIIEEEPTWIIMELYSYGELGHYLERNKNSMKVLTLVLYSLQICKAMAYLE
SINCVHRDIAVRNILVASAECVKLGDFGLSRYIEEEDYYKASVTRLPIKWMSPESINFRR
FTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRC
WDYDPSERPRFTELVCSLSDIYQMEKDIAIEQERNARYRPPKILEPIAFQEPPPKPSRPK
YRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLQRHNVFKRHSMRE
EDFIRPSSREEAQQLWEAERLKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPL
TPEKEAGYTEFTAPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQL
PPEAYVVVVKNVGLTLRKLIGSVDNLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQ
QNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3027 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagccgagtgaaggtgggcacgttacggcggccggaa
ggccccccagagcccatggtggtgccagtagacgtggaaaaggaagacgtgcggatactc
aaggtctgcttctataacaacagcttcaatcctgggaagaacttcaaactggttaaatgc
actgtgcagactgagatccgggaggtcattgcctccatcctgctgagcgggcggatcggg
cccaacatccagctggctgagtgctatgggctgaggctgaagcacatgaagtctgatgag
atccactggctgcacccgcagatgacagtgggtgaggtgcaggacaagtacgagtgtcta
catgtggaagccgaatggaggtatgaccttcaaatccgctacttgccagaggacttcatg
gagagcctgaaaaaagacaggaccacactgctttatttttaccaacagctccggaatgac
tacatgcaacgctatgccagcaaggtcagcgagggcatggccctgcagctgggctgtctg
gagctcaggaggttcttcaaggacatgccccacaacgcacttgacaaaaaatccaacttt
gagctcctggagaaagaagtgggtctggacctgtttttcccaaagcagatgcaggagaac
ttaaagcccaagcagttccggaagatgatccagcagacgttccagcagtatgcctcgctc
agggaggaggagtgtgtcatgaagttcttcaacaccctcgctggctttgccaacatcgac
caggagacctatcgctgtgaactcattcaaggatggaacatcactgtggacctggtcatc
ggccctaaaggcatccgccagctgacaagtcaagatgcaaagcccacctgcctggccgag
ttcaagcagatcaagtccatcaggtgcctcctactggaggaagaccaagcggctctgcag
ctgggcatcgaaggcgccccccagtccttgtccatcaaaacttcctctctggcagaggcc
gagaacatggctgacctcatagatggttactgccggctgcagggagagcacaaaggctct
ctcatcattcatcccaagaaagatggtgagaagcgaaacagcctgccccagatccccgtg
ctaaatgtggaggttcagcggccctacctctcagaaagctgcagcatagaatcagacatc
tacgctgagatccctgatgagactctgcgaaggccaggaggcccacagtatggcattgcc
cgggaagatgtggttctgaatcgtattcttggcgaaggcttttttggggaggtctatgaa
ggtgtctacacaaaccacaaaggggagaaaatcaatgtagctgtgaagacctgtaagaaa
gactgcactctcgacaacaaggagaagttcatgagtgaggcagtgatcatgaagaacctg
gaccacccgcatattgtgaagctgataggcatcatcgaagaggagcccacctggatcatc
atggaattgtattcctatggggagctgggacactacctggagcggaacaagaactctatg
aaggtgctcaccctcgtcctgtactcgctgcagatttgcaaggccatggcttacctggag
agcatcaactgtgtccacagggacattgccgtccgaaacatcctggtggcctctgctgag
tgcgtgaagctgggagactttggcctttcccgatacattgaggaggaggactattacaaa
gcctctgtgactcgtctgcccatcaaatggatgtcacctgagtctattaacttccgccgc
ttcaccacagccagtgatgtctggatgtttgccgtgtgcatgtgggagatcctaagcttt
ggcaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctcgagaagggc
gaccgactccccaagcccgacctctgcccacctgttctctacactctcatgacccgctgc
tgggactacgaccccagtgagcggccccgcttcactgagctcgtgtgtagcctcagtgac
atttatcaaatggagaaggacattgctatagagcaggagaggaatgctcgctaccgtcct
cccaaaatcttggagcccatagcatttcaggaacccccgcccaagcccagccggcccaag
tacagaccccctccacagaccaaccttctggctcccaagctgcaattccaggtccctgag
ggtctgtgtgccagctcgcctacgctcaccagccctatggagtacccatctcctgtaaac
tcgctgcacacaccgcctctccaacgacacaatgtcttcaagcgccacagcatgcgggag
gaggactttatccgacccagcagccgggaagaggcccagcagctatgggaggccgagagg
ctcaagatgcggcagatcctggacaagcagcagaagcagatggtggaagattaccagtgg
ctgaggcaggaggagaaatccctggaccccatggtttacatgaacgacaagtccccattg
accccagagaaggaggccggttacacggaatttacagcccccccacagaagccaccacgg
ttaggcgcccagtccatccagcccacagccaacctggatcggaccgacgacctggtgtac
ctcaatgtcatggagctggtacgggccgtgctggacctcaagaatgagctctgtcagctg
cctcctgaggcctacgtggtggtggtgaagaatgtgggcctgaccctgcggaagctcatc
gggagtgtggacaatctcctgccctccttgccatcatcttcgcggacagagattgaaggg
acccagaaactgctcaacaaggacctggcagagctcatcaataagatgcgactggcccag
caaaacgccgtgacttccctgagcgaggagtgtaagcggcagatgctcacagcctctcac
accctggctgtggacgccaagaacctgctcgatgctgtggaccaggccaaggttctggcc
aacctggcccacccgcctgcagagtga

DBGET integrated database retrieval system