KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515469
Entry
107515469         CDS       T06036                                 

Gene name
GLP1R
Definition
(RefSeq) LOW QUALITY PROTEIN: glucagon-like peptide 1 receptor
  KO
K04581  glucagon-like peptide 1 receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107515469 (GLP1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515469 (GLP1R)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107515469 (GLP1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107515469 (GLP1R)
G protein-coupled receptors [BR:ray04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    107515469 (GLP1R)
SSDB
Motif
Pfam: 7tm_2 HRM Dicty_CAR FixP_N
Other DBs
NCBI-GeneID: 107515469
NCBI-ProteinID: XP_016009809
LinkDB
Position
Unknown
AA seq 462 aa
MAGAPALRLALLLLGXVGRAGPRPQGATVSLSETVQKWREYRRQCQRFLTEAPPPATGLF
CNRTFDDYACWPDGLPGSFVNVSCPWYLPWANSVLQGHVYRFCTADGLWLYKDNSSLPWR
DLSECEESKRGERSSPEDQLLSLYVIYTVGYALSFSALVIASAILLSFRHLHCTRNYIHL
NLFASFILRALSVFVKDTALKWMYSTAAQQHQWDGLLSYQNSLGCRLVFLLMQYCVAANY
YWLLVEGVYLYTLLALSVFSEQRVFRLYLTIGWGVPLLFVIPWGIVKYLYEDEGCWTRNS
NMNYWLIIRLPILFAIGVNFLIFIRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLG
THEVIFAFVMDEHARGTLRFIKLLTELSFTSFQGLMVAILYCFVNSEVQMEFRKSWERWR
LEHLHIQRDSSMKPLKCPTSSLSSGGTVGSSVYAATCQVSCS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccggcgccccggccctccgcctggcgctgctgctgctcgggncggtgggcagggcc
ggcccccgcccccagggtgccactgtgtccctctccgagacagtacagaaatggcgagaa
tatcgacgccagtgccagcgcttcctgactgaggctccacccccagccacaggcctgttc
tgcaaccggactttcgatgactatgcctgctggccagatgggctgcccggctccttcgtg
aatgtcagctgcccctggtaccttccctgggccaatagtgtgctacagggtcatgtgtac
cgattctgcacagctgacggcctgtggctatacaaggacaactccagcctgccctggagg
gacctgtcagagtgtgaggagtccaagcgaggggaaagaagctccccggaggaccagctc
ctgtccctttacgtcatctacacagtgggctatgcgctctccttctctgctctggtcatc
gcctcggccattctcctcagcttcagacacctgcactgcacccggaactacattcaccta
aacttgtttgcatccttcatcctccgcgcgttgtctgtcttcgtcaaggacacagccctc
aagtggatgtacagcacggctgcccagcagcaccagtgggatgggctcctctcctaccag
aattctctgggctgccgcctggtgttcctgctcatgcagtactgcgtggcggccaattac
tactggctcctggtggaaggtgtgtacctgtacacgctgctggccctctcagtcttctcg
gagcagcgcgtcttcaggctctacctgaccataggctggggtgttcccctgctgtttgtt
atcccctggggcattgtcaagtacctctatgaggatgagggctgctggaccaggaactcg
aacatgaattactggctcatcatccggctgcccatcctctttgccattggggtgaatttc
ctcatctttatccgagtcatctgcattgtggtgtccaaactgaaagccaatctcatgtgc
aagacagacatcaagtgcagacttgccaagtccacactgaccctcatccccctgctgggg
acccacgaggtcatcttcgccttcgtgatggatgagcacgcccgggggaccctgcgcttc
atcaagctgctcacagagctctccttcacctccttccaggggctgatggtggccattttg
tactgctttgtcaacagtgaggtccagatggagtttcggaagagctgggaacgctggcga
ctcgagcacttgcacatccagagggacagcagcatgaagcccctcaagtgtcccaccagc
agcctgagcagcgggggcacggtgggtagcagcgtgtacgcagccacctgccaggtctcc
tgcagctaa

DBGET integrated database retrieval system