KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515476
Entry
107515476         CDS       T06036                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1
  KO
K16366  endothelin-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
ray04668  TNF signaling pathway
ray04916  Melanogenesis
ray04924  Renin secretion
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05200  Pathways in cancer
ray05410  Hypertrophic cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107515476 (EDN1)
   04066 HIF-1 signaling pathway
    107515476 (EDN1)
   04024 cAMP signaling pathway
    107515476 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515476 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107515476 (EDN1)
   04916 Melanogenesis
    107515476 (EDN1)
   04924 Renin secretion
    107515476 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107515476 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515476 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107515476 (EDN1)
   05410 Hypertrophic cardiomyopathy
    107515476 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515476 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 107515476
NCBI-ProteinID: XP_016009829
LinkDB
Position
Unknown
AA seq 203 aa
MDYFPMIFSLLFVAFQGAPETAVLGAELSTGANDGGEKPSPSDPWRPRRRSKRCSCSSLM
DKECVYFCHLDIIWVNTPEHIVPYGLGSPSRSKRSLKDLFPTKTTDHKNRCQCASQKDKK
CWNFCQAGKELRDQDTVEKGWNDHKKGKDCSKFGKTCIHQQLVEGRKLRRLEAIGNSIKT
SFRIAKLKTELYREKKVNHNRTH
NT seq 612 nt   +upstreamnt  +downstreamnt
atggattatttccccatgattttctctctgctgtttgtggctttccaaggagctccagaa
acagctgttttgggtgctgagctcagcacgggggccaacgatggaggagagaagccctct
cccagtgacccctggaggccccgccgccgctcgaagcgctgctcctgctcttccttgatg
gataaagagtgtgtctacttctgccacctggacatcatctgggtcaacactcccgagcat
attgttccgtatggacttggaagcccttctaggtccaaacgatccttaaaggatttattt
cctacaaaaacaacagaccacaagaatagatgccaatgtgctagccaaaaagacaagaag
tgctggaatttttgccaagcaggaaaagaactcagggaccaagacactgtggagaaaggc
tggaatgaccataagaaaggaaaagactgttctaagtttggaaagacatgtattcatcag
cagctggtagaaggaagaaaactaagaaggttggaggccatcggcaacagcatcaaaaca
tcttttcgtattgcaaagctgaaaactgaactctacagagagaagaaagtgaaccacaac
cgaacacactga

DBGET integrated database retrieval system