KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515478
Entry
107515478         CDS       T06036                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04730  Long-term depression
ray04740  Olfactory transduction
ray04923  Regulation of lipolysis in adipocytes
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107515478 (PRKG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107515478 (PRKG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107515478 (PRKG1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107515478 (PRKG1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107515478 (PRKG1)
  09154 Digestive system
   04970 Salivary secretion
    107515478 (PRKG1)
  09156 Nervous system
   04730 Long-term depression
    107515478 (PRKG1)
  09157 Sensory system
   04740 Olfactory transduction
    107515478 (PRKG1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107515478 (PRKG1)
   04714 Thermogenesis
    107515478 (PRKG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515478 (PRKG1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     107515478 (PRKG1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKG family
   107515478 (PRKG1)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like Med4 Med28 APH Pkinase_C Spc7 PKcGMP_CC
Other DBs
NCBI-GeneID: 107515478
NCBI-ProteinID: XP_016009830
LinkDB
Position
Unknown
AA seq 686 aa
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGETRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPIFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIVK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgggcaccctgcgggatttacagtacgcgctccaggagaagatcgaggagctgaggcaa
cgggatgctctcatagacgagctggagctagagttagatcagaaggacgaactgatccag
aagctgcaaaacgagctggacaagtaccgctcggtgatccggccggccacccaacaggcg
cagaagcagagcgccagcaccttgcagggcgagacgcgcactaagcggcaggcgatctcc
gctgagcccaccgccttcgacatccaggatctcagccatgtgaccctgcccttctacccc
aagagcccacagtccaaggatctcattaaggaagccatccttgacaatgactttatgaag
aacttggagctgtcacagatccaggagattgtggattgtatgtacccagtggagtatgga
aaagacagttgcatcatcaaagaaggagatgtggggtcactggtgtatgtcatggaagat
ggcaaggttgaagtcactaaagaaggagtgaagctgtgcaccatgggtccggggaaagtg
ttcggggagttggccattctctacaattgtactcggacagcgaccgtcaagactcttgta
aatgtgaagctctgggctattgatcgacaatgttttcaaacaataatgatgaggacagga
ctcatcaagcatacggagtatatggaatttttaaaaagcgttccaacattccagagcctt
cctgaggagatcctcagtaagcttgcagacgtccttgaagagacccactatgaaaatggg
gaatatatcatcagacaaggtgcaagaggggacacgttctttatcatcagcaaaggaaag
gtaaatgtcactcgtgaagactcaccaagtgaagacccaatctttcttagaactttagga
aaaggagattggtttggagagaaagccttgcagggggaagatgtaagaacggcaaacgta
attgctgcagaagctgtcacctgccttgtgatcgacagagactctttcaagcatttgatt
ggaggattggatgatgtttctaataaagcatatgaggatgcagaagctaaagcaaaatat
gaagctgaagctgctttcttcgccaacctgaagctgtctgatttcaacatcattgacacc
ctcggagtcggaggtttcgggcgagttgaactggtccagttgaaaagtgaagaatccaaa
acctttgccatgaagattctcaagaaacgccacatcgtggatacaagacagcaagagcac
atccgctcagagaagcagatcatgcagggagctcattctgacttcatagtgagactatac
agaacatttaaggacagcaaatatttgtatatgttgatggaagcttgcctaggtggagag
ctctggaccattctcagggatagaggttcatttgaagattctacaaccagattttacaca
gcatgtgtggtggaagcttttgcctatctgcattccaaaggcatcatttacagagacctc
aagccagaaaatctcatcctagatcaccgaggttatgccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccagagtatgta
gccccagagatcatcttgaacaaaggccatgacatttcagccgactattggtcactggga
atcctaatgtatgaacttctgactggcagcccacctttctcaggcccagatcctatgaaa
acctataacatcatattgaggggcattgacatgatagaatttccaaagaagattgtcaaa
aatgctgctaatttaattaaaaaactatgcagggacaatccatcagaaagattggggaat
ttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgagggctttaattgggaa
ggcttaagaaaaggcaccttgacacctcctataataccaagtgttgcatcacccacagac
acaagcaattttgacagtttccctgaggacaatgatgaaccaccacctgatgacaactca
ggatgggacatagacttctaa

DBGET integrated database retrieval system