KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515549
Entry
107515549         CDS       T06036                                 

Gene name
SLK
Definition
(RefSeq) STE20-like serine/threonine-protein kinase isoform X1
  KO
K08836  STE20-like kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107515549 (SLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515549 (SLK)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107515549 (SLK)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE20 family
   107515549 (SLK)
SSDB
Motif
Pfam: PKK Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 107515549
NCBI-ProteinID: XP_016009946
LinkDB
Position
Unknown
AA seq 1240 aa
MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEEFWEIIGELGDGAFGKVYKAQNKETNVLA
AAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVM
LELERPLTESQIQVVCRQTLEALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKN
TRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNP
MRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDSRWTTSQLLQHPFVTVDSNKPI
RELIAEAKAEVTEEVEDGKEEEEDDETENSLPIPASKRASSDLSIASSEEDKLSQNACIL
ESVSEKIERNTRKDKFNNRVLNEKLITNEPEKAVEVTDEHINDTNLEDMAELHTRTTIIK
ENGREEKRPRLENLPDTEDQETVDINSVSEGKENNTVITLETNNEQNLKPEEERDQEKQQ
IFENKVITSEEIKDITIQTMDLVSQETGEKEASIQAIDNEVELTDIQKNLVNDEKTQKDA
IGDTSNAVGTNEAVDVVRKAVENNAEDAQNNDGKEMVEVGQELVSKSTESPEVICTEEVP
VKEIVETNEIDQKSVEGKGEEQLINISKNRVETNEEPRTNEVEQITESSSTEEIEVSGAV
IHTDQKPLGSETQDAHEATTQTDTEQKEIPCEVPIKTEPEVTATSKPSEPQPVPIPSINI
NSEDTESKGEIGASSKTETLLIPESENQKENDTDSGTGSTADNSSIDLNLSISSFLSKTK
DSGSISLQETRRQKKTLKKTRKFVVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELR
FLQKEEQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQE
HTNRLRDEAKRIKGEQEKELSKFQSMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQS
QHAQEQEFVQKQQQELDGSLKKIIQQQKAELANIERECLNNKQQLMRVREAAIWELEERH
LQEKHQLLKQQLKDQYFMQRHQLLKRHEKETEQMQRYNQRLIEELKNRQTQERARLPKIQ
RSEAKTRMAMFKKSLRINSTATPDQDREKIKQFATQEEKRQKNERMAQHQKHENQMRDLQ
LQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFAR
KLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS
NT seq 3723 nt   +upstreamnt  +downstreamnt
atgtccttcttcaatttccgtaagatcttcaagttggggagcgagaagaagaagaagcag
tacgaacatgtgaagagggatttgaaccctgaggagttttgggaaattataggagaattg
ggtgacggagcctttgggaaagtgtacaaggcccagaataaagagaccaatgttttagct
gctgcaaaggtgattgataccaaatctgaagaagaacttgaagattacatggtagaaatt
gatattttagcatcttgtgatcacccaaatatagtcaagcttctagatgccttctattat
gagaacaatctttggatccttattgaattttgtgcaggaggagcagtggatgctgtgatg
cttgaacttgagagaccattaactgagtcccaaatacaagtagtgtgtagacagacctta
gaggcgttgaactacttacatgataacaaaattatccacagagatctaaaggctggcaac
attctttttaccttagatggagatattaagttggcggattttggagtatcagctaaaaac
acaaggacaattcaaagaagagattcctttattggcacaccatattggatggctcctgaa
gtagtcatgtgtgaaacatctaaggacagaccctatgactacaaagctgatgtttggtcc
ctgggaatcactttaatagaaatggctgagatagaaccacctcatcatgaattaaatcca
atgcgagtgctactaaaaatagcaaaatctgagccccctacattagcacaaccatcaaga
tggtcttcaaattttaaggattttctaaaaaaatgcttggaaaaaaatgtggattccaga
tggactacatctcaactactgcagcatccctttgttactgttgattccaacaaaccaatc
cgagagttgattgcagaagcaaaggctgaagtaacagaagaagttgaagatggcaaagag
gaggaggaggatgatgaaacagaaaattctctgccaatacctgcaagtaagcgtgcctcc
tctgaccttagtattgccagctctgaagaggataaactttcacaaaatgcttgcatattg
gaatctgtctcagaaaaaatagaacgtaatactcgtaaagataaatttaacaacagagtt
cttaatgaaaaacttatcaccaatgagcctgaaaaagctgtggaggttactgatgaacat
attaatgatactaatttagaagatatggctgaacttcatactagaacaacaataatcaag
gaaaatgggagagaagagaagagacctaggcttgaaaatctacctgacacagaagaccaa
gaaacagtagacattaattcagtcagtgaaggaaaagagaataatacagtgataacttta
gaaacaaataatgagcagaatctgaaacctgaggaagaaagggatcaggaaaagcaacag
atatttgaaaataaagttataacatctgaagaaattaaagatattactattcaaacaatg
gatttagtttctcaagagactggagaaaaagaggcaagtattcaggcaattgacaatgaa
gttgaacttacagacatccaaaagaatttggtaaacgatgagaaaactcaaaaagatgcg
attggtgatacaagcaatgcagtaggaacaaacgaggcagtagatgttgttcggaaggca
gtcgaaaataatgctgaggatgctcagaataatgatgggaaagaaatggttgaagtaggc
caggaattagtaagtaaatctacagagagtcctgaggttatttgtactgaggaagttcct
gttaaagaaatagtcgaaactaatgagatagatcaaaaatctgtagaaggtaaaggtgag
gaacagttaatcaacatttctaagaacagagtggagaccaatgaggaacccaggacaaat
gaagttgagcaaattacggagtcaagtagcactgaagaaatagaggtcagcggtgcagtg
attcatactgaccaaaagcctttaggaagtgaaacgcaggatgctcatgaagccactact
caaacagatacagagcaaaaggaaattccatgtgaagtgccaattaaaacagaacctgaa
gttacagccacttcaaagcccagtgaacctcagcccgtcccaatacccagtattaatatc
aattctgaagatacagaaagtaaaggagaaataggtgcttcatcaaaaactgaaaccctg
ctaataccagaatctgagaatcagaaggaaaatgatactgattcaggcactggttctact
gctgataatagcagcattgacttgaatttatccatctctagcttcctaagcaaaactaaa
gacagtggatcaatatctttacaagaaacaagaagacaaaagaaaacattgaagaaaaca
cgcaaatttgttgttgatggtgtagaagtgagtgtaacaacatcaaagatagttacggat
agtgattccaaaactgaagaattgaggtttcttagacgtcaggaacttcgggaattaaga
tttcttcaaaaagaagagcaaagagcccaacaacagctcaatagcaaactgcaacagcaa
cgagaacaaattttccggcgctttgagcaagaaatgatgagcaaaaagcgacagtatgac
caagaaatcgagaatctagaaaaacaacagaaacagactattgaacgtctagaacaagaa
cacacaaatcgcttacgagatgaagccaaacgcattaaaggagaacaagagaaagagttg
tccaaatttcagagtatgttgaagaaccgaaagaaggaggttataaatgaagtggagaaa
gcacccaaagagctgagaaaagagctcatgaaacgcaggaaagaggagcttgcacaaagc
cagcatgctcaggaacaagagtttgttcagaagcaacaacaagaattagatggctctctg
aaaaagatcatccaacagcagaaggcagagttagccaatattgaaagagagtgtctgaat
aataaacaacagctcatgagagttcgagaagctgcaatttgggagcttgaagaacgacac
ttacaagaaaaacatcagctgctcaaacagcaacttaaagatcagtatttcatgcaaaga
catcagctacttaagcgtcatgaaaaggaaacagaacaaatgcagcgttacaatcaacga
cttattgaagaattgaaaaacagacagactcaagaaagagctagactgcctaagattcag
cgcagtgaagctaagactcgaatggctatgtttaagaaaagtttgagaattaactcaaca
gccacaccagatcaggaccgtgaaaaaattaaacagtttgctactcaagaagaaaagagg
cagaaaaatgagagaatggctcaacatcaaaaacatgaaaatcaaatgcgggatctgcag
ttgcagtgtgaagccaatgtccgagagctgcatcaactgcagaatgaaaaatgccacctg
ttggttgagcatgagactcagaaactaaaggaattagatgaggaacacagccaggaatta
aaggaatggagagagaaattaagacctaggaaaaagacactggaagaagaatttgccagg
aaactgcaggaacaggaagtgttctttaaaatgacgggggagtctgagtgccttaatcca
tctacacaaagccggatttccaaattctatcctattcctagcttgcattccactggatcg
taa

DBGET integrated database retrieval system