KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515574
Entry
107515574         CDS       T06036                                 

Gene name
SUFU
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04340  Hedgehog signaling pathway
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107515574 (SUFU)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515574 (SUFU)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107515574 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 107515574
NCBI-ProteinID: XP_016010012
LinkDB
Position
Unknown
AA seq 485 aa
MAELRPSGAPGPAAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDSRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLTHDRAPSRKDSLESDSSTAIIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcggcgcccccggccccgccgcgcccccggcccctggccct
actgccccgccggccttcgcttcgctctttcctcctggactgcacgccatctacggagag
tgtcgccgcctgtaccctgaccagccgaacccactccaggttacagctatcgtcaagtac
tggttgggtggcccagaccccttggactatgttagcatgtacaggaacatggggagccct
tctgccaacatccctgagcactggcactacatcagcttcggcctgagcgatctctatggt
gacagcagagttcatgaatttacaggaacagatggacctagtggttttggctttgagttg
acatttcgtctgaagagagaaacaggggagtctgctcccccaacgtggccagcagagcta
atgcagggcttggccagatatgtgttccagtcagagaacaccttctgcagcggggaccac
gtgtcttggcacagccctttggataacagtgagtcaaggattcagcacatgcttctgaca
gaggacccgcagatgcaacctgtacagacaccctttggggtagttaccttcctccagatt
gttggcgtctgcactgaggagctccatgcagcccagcagtggaatgggcaaggcatcctg
gagctgctgcggacagtgcccgtcgctggtggcccctggctgataactgacatgcggagg
ggagagaccatatttgagatcgatccacacctgcaacaggagagagttgacaaaggcatc
gagacggacggctccaatctaagcggtgtcagtgccaagtgtgcttgggatgacctgagc
cggccccctgaggatgacgaggacagccggagcatttgcattggcacacagccccggcgg
ctctctggcaaagacacagagcagatccgggagaccctgaggagaggacttgagatcaac
agcaaacctgtccttccaccaatcaaccctcagcggcagaacggcctcacccatgaccgg
gccccgagccgcaaagacagcctggaaagcgacagctccacggccattattccccatgag
ctgatccgcacacggcaacttgagagtgtacatctgaagttcaatcaggaatcaggagcg
ctcattcctctctgcctaaggggcaggctcctgcatggacggcactttacatataaaagt
atcacaggtgacatggccatcacattcgtctccactggagtggaaggtgcctttgccact
gaggagcacccttacgcagctcatggaccctggttacaaattctgttgactgaagagttt
gtagagaaaatgttggaggacttagaagatttgacttctccagaggaattcaaacttccc
aaagagtacagctggccagaaaagaagctgaaagtctccatcctacctgacgtggtgttc
gacagtccactgcactag

DBGET integrated database retrieval system