KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515669
Entry
107515669         CDS       T06036                                 

Gene name
VAMP2
Definition
(RefSeq) vesicle-associated membrane protein 2 isoform X1
  KO
K13504  vesicle-associated membrane protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04130  SNARE interactions in vesicular transport
ray04721  Synaptic vesicle cycle
ray04911  Insulin secretion
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107515669 (VAMP2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107515669 (VAMP2)
  09154 Digestive system
   04970 Salivary secretion
    107515669 (VAMP2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107515669 (VAMP2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    107515669 (VAMP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107515669 (VAMP2)
Membrane trafficking [BR:ray04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    107515669 (VAMP2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107515669 (VAMP2)
SSDB
Motif
Pfam: Synaptobrevin Orf78 MCU MgtE PRIMA1 Tweety DUF2970 Ferlin_C DUF2207 ODV-E18
Other DBs
NCBI-GeneID: 107515669
NCBI-ProteinID: XP_016010208
LinkDB
Position
Unknown
AA seq 135 aa
MPLMCAPCMSPGVLGMFCMCPWHGSLATAGCMFFMWARGRGVPSLRWALAHPLLRGPLLQ
VVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGV
ICAIILIIIIVYFSS
NT seq 408 nt   +upstreamnt  +downstreamnt
atgcccctgatgtgtgctccttgcatgtccccaggtgtgctaggtatgttctgtatgtgt
ccttggcatggtagcctggcaacagcggggtgcatgttctttatgtgggcacgtggtcga
ggagtgccctcattgaggtgggccttggcacaccccctgcttcgtgggcccctcctccag
gtggtggacatcatgagggtgaacgtggacaaggtcctggagcgggaccagaagctttcg
gagctggacgaccgtgcagatgcactccaggcgggggcctcccagtttgaaacaagtgca
gccaagcttaagcgcaaatactggtggaaaaacctcaagatgatgatcatcttgggagtg
atttgcgccatcatcctcatcatcatcatcgtttacttcagctcttaa

DBGET integrated database retrieval system