KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515672
Entry
107515672         CDS       T06036                                 

Gene name
GUCY2D
Definition
(RefSeq) retinal guanylyl cyclase 1 isoform X1
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04740  Olfactory transduction
ray04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107515672 (GUCY2D)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107515672 (GUCY2D)
   04740 Olfactory transduction
    107515672 (GUCY2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515672 (GUCY2D)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107515672 (GUCY2D)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107515672 (GUCY2D)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Kinase-like OapA
Other DBs
NCBI-GeneID: 107515672
NCBI-ProteinID: XP_016010219
LinkDB
Position
Unknown
AA seq 1128 aa
MDRKGSNRKQDKDGDATLAMTVCIFLADGFRNPRLCARERWAPFPPRLLQALPWPRPRLR
LLLLLLLLPPSALSAVFTVGVLGPWACDPIFARARPDLAARLAASRLNQDPALKGGPRFE
VALLPEPCRTPGSLGAVSSALAHVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRA
AGTTAPAVTPAADALYALLRGFRWARVALITSPQDLWVEAGRSLATALRARGLPVALVTA
MEPSDLSGAREALRRVQDGPKVRAVIMVMHSVLLGGEEQRCLLEAAEELGLVDGSLVFLP
FDTLHYALSPGPETLAVLANSSQLRRAHDAVLTLTRHCPPGGSVLDSLRRAQEHQELPPD
LNLQQVSPLFGTIYDAVFLLAGGVARARAAVGGSWVSGAAVARHVQNAQVSGFCGVLGGA
EEAPFVVLDTDEAGDRLFATYVLDPTRGSFRSAGNPVHFPRGGRGPGPDPSCWFDPNIIC
NGGVEPGLVFIGFLLVVGMGLTGAFLAHYVRHRLLHIQMVSGPNKIILTLDDITFLHPQG
GSSRKVAQGSRSSLTARSVSDIRSVPSQVPESSTIGLYEGDWVWLKKFPGDQHIAIRPAT
KTAFSKLRELRHENVALYLGLFLAGGADSTAAPGEGMLAVVSEHCARGSLHDLLAQRDIK
LDWMFKSSLLLDLIKGMRYLHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQKVL
PEPPSAEDQLWTAPELLRDPALERRGTLAGDVFSLGIIMQEVVCRSAPYAMLELTPEEVV
QKVQSPPPLCRPLVSMDQAPMECIQLMKQCWAEQPDLRPSMDRTFDLFKSINKGRKTNII
DSMLRMLEQYSSNLEDLIRERTEELELEKQKTDQLLTQMLPPSVAEALKMGTPVEPEYFE
EVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGL
PQRNGQRHAAEIANMALDILSAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYC
LFGDTVNTASRMESTGLPYRIHVNVSTIRILHALNEGFQTEVRGLTELKGKGAEDTYWLV
GRRGFDKPIPKPPDLQLGASNHGIDLQEIPPERRRKLEKARPGQFSGK
NT seq 3387 nt   +upstreamnt  +downstreamnt
atggacagaaaagggagtaacaggaagcaggacaaagacggggatgcgacgctggcgatg
accgtctgcatcttccttgcggatggctttcggaacccccggctctgcgcccgggagcgg
tgggctccattcccgccccgcctcctccaggcgttgccctggccccggcctaggcttcgg
ctactgctgctgctgctgctcctgccgccctctgccctctctgctgtattcacagtgggg
gtgctaggaccctgggcctgcgaccccatcttcgctcgtgcccgcccagacctggctgcc
cgcctggccgcctcccgcctgaaccaagacccagccctgaaaggcggcccccgcttcgag
gtcgcactcctgccggagccgtgccggacccctggctcgctgggggcagtgtcgtctgct
ctggcccatgtctctggtctcgtgggtccggtgaaccctgcagcctgtcggccggctgaa
ctactagcccaagaggcgggggttgcgctggtgccctggggctgcccggggacacgagcg
gcgggcaccaccgcccccgcagtgacgcccgcggcggatgccctctacgccctccttcgc
ggcttccgctgggcgcgtgtggccctgatcacctccccccaggacctgtgggtggaagct
ggacgctccctagccactgcactcagggcccgggggctgcccgttgccctggtgaccgcc
atggagccctcggacttgtctggagctcgggaggccctgagaagggtccaagatgggccc
aaagtccgagcagtgatcatggtgatgcattcggtgctgctgggcggcgaggagcagcgc
tgcctgctggaggctgcagaggagctgggcctggtcgacggctccctggtcttcctgccc
tttgacacgcttcactacgccttgtccccaggcccggagaccttggccgtgctagccaac
agctcacagcttcgcagggcccacgatgcggtgctcacccttacgcgccactgtccccct
gggggcagtgtgctggacagcctgcgcagggcccaagagcatcaggagctgccccctgac
cttaatctgcaacaggtatccccactctttggcaccatctatgatgcggtcttcttgttg
gccggtggtgtggcacgagctcgggcagctgtaggtggcagctgggtgtccggagcagcc
gtggcccgccacgtccagaatgcccaggtctcaggcttttgtggcgtcctgggaggagct
gaagaggccccatttgtggtgctggacacagatgaggcgggggaccggctatttgctaca
tacgtgcttgaccccacccggggctccttccgctctgctgggaacccggtgcatttcccc
agagggggacggggacctgggcctgacccctcttgctggtttgacccaaacatcatctgc
aatggaggagtggagcctggccttgtctttatcggcttcctccttgtggttgggatgggg
ctgacaggggccttcctggcccattatgtgaggcaccggctacttcacattcaaatggtt
tccggccccaacaagatcatcctgactttggacgacatcaccttcctccacccgcaaggg
ggcagctctcgaaaggtggcccagggtagtcggtcgagtctgactgctcgcagtgtgtca
gacattcgcagcgtccccagccaggtcccggagagctccaccattggcctctatgaggga
gactgggtttggctgaagaaattcccaggggatcagcacatagccatccgcccagcaacc
aagacagccttttccaagctcagagagctccggcacgagaacgtggccctctacctgggg
ctcttcctggcaggaggagcagacagcaccgcggcccccggggaaggcatgctggctgtg
gtctcagagcactgtgccaggggctccctccatgacctactcgcccagagagatataaag
ctggactggatgtttaagtcctcactcttactggatcttatcaagggaatgagatatctg
catcatcgaggtgtggcccatgggcgacttaagtcccggaactgcgtggtggacgggagg
ttcgtgctcaaagtcaccgaccacggccacgggcgactgctggaagcccagaaggtgtta
ccagagcctcccagcgcagaggaccaactatggacagccccagaactgcttcgagacccg
gccctggagcgccggggaacgctggccggcgacgtcttcagtctgggcatcatcatgcag
gaggtcgtgtgccgcagcgccccctatgccatgctggagctgactcccgaggaagtggtg
cagaaagtgcagagccctcctccactgtgtcggcctttggtttccatggaccaggcgccc
atggagtgcatccagctgatgaaacagtgctgggcagagcagccggaccttcggccttcc
atggaccgcaccttcgacctgttcaagagcatcaacaagggccggaagaccaacatcatt
gactcaatgctgcggatgctagagcagtattccagtaacctggaagacctgatcagagag
cgcacggaggagctagagctggaaaagcagaaaacagaccagctgctcacacagatgctc
cctccgtctgtggctgaggctctaaagatggggacacctgtggagcctgaatattttgag
gaggtgacattgtacttcagtgacatagtgggctttaccacaatctcagccatgagtgag
cccatcgaagtagtggacctgcttaacgacctctatacactctttgatgccatcatcggc
tctcatgatgtctacaaggtggagacaattggggacgcctatatggtggcctctgggctg
ccccagcgaaatgggcagcgacacgcagcagaaatcgccaatatggcactggatatcctc
agcgcagtgggctccttccgcatgcgccacatgcccgaggtgcctgtgcgcatccgtatt
ggcctgcattcgggcccatgcgtggcgggtgtagtgggcctcaccatgccgcggtactgc
ctgtttggggacacggtcaacacagcctcgcgcatggaatccacagggctgccttaccgc
atccacgtgaatgtgagcaccatacggatcctccacgctctcaacgagggcttccagact
gaggtgcgaggcctcacggagctaaagggcaagggcgcagaggacacgtactggctggtg
ggcagacgaggcttcgacaagcccatccccaagccgcctgacttgcaactgggggccagc
aatcatggcattgacctgcaggaaatccctcccgaaaggcgcaggaaactggagaaggcg
aggcccggccagttctctgggaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519122
Entry
107519122         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory guanylyl cyclase GC-D-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04740  Olfactory transduction
ray04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107519122
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    107519122
   04740 Olfactory transduction
    107519122
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519122
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107519122
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107519122
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA
Other DBs
NCBI-GeneID: 107519122
NCBI-ProteinID: XP_016016884
LinkDB
Position
Unknown
AA seq 1179 aa
MKQFPGRSLWKLKGSRSGDCTGGGGSGSSPGQSLFEEFDARGPWCKNLRIHKEAVSQPQM
HNMAGLQGCLYPEGWYWTLPRRKTCLPCQVPWGSTLSHSRTVPSLPLLSVVLWGALLWAG
SLPDLVWGARTFTVGVLGPWDCDPIFAQAIPSAAAQLAVDRANQDSSLMLSLQLASVVLP
TGCDTPHALTTFLAHKNTVAAFVGPVNPGYCPAAALLAQGWDKTLFSWACGAPEGGGNLV
PTLPSAAHVLLSIMRHFGWARVAIVSSHQDIWVATAREVAMTLRTHGLPVELVTSLGPGE
QGATEVLKQLCSIDGLKIVVLCMHSALLGGSEQTALLRRAWAQGLADGRLVFLPYDTMLF
SLPYHNRSYPALGHMGPLREVYDAVLTISLESSPTDKAFEAAGANEKVAVHLETEQVSPL
FGTIYDAVVLLAHALNRSESHGAGLLGAHLGDHIGALDVAGFSQRIRTDEKGRRLAQYVI
LDTDGQESQLVPTHILDTGTWQVQPLGRAIHFPGGAPPARDSSCWFDPNTLCMRGTQPPG
SLLAVALACVLVLTGGALICLIRVGIQQLQLARGPHRILLTAQELTFIHQALSRRRLHVD
SASESRSAMDGGSLRSVSQGSARSLPAPQEPTNVALYQGEWVWLKKFEAGTALELRPDCL
SLLRKMRELRHDNVATCLGFFTAPGISALVLEHCARGSLEDLLRNEALRLDWTFKASLLL
DLIQGVRYLHHRHFPHGRLKSRNCVVDGRFVLKVTDHGYAELLDAQRAPRPPPVPEELLW
TAPELLRDPGRGTLKGDVFSIGIILQEVLTRGPPYGSSGLSAEEIIRKVASPPPLCRPRV
SPDHGPPECIQLMEQCWEEAPEHRPSLDQIYTQFKSINQGKKTSVADSMLRMLEKYSQNL
EDLIQERTEELELERQKTERLLSQMLPPSVAKALKMGMTVEPEYFDQVTIYFSDIVGFTT
IAALSEPIEVVGLLNDLYTLFDAVLGSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIAN
MALDILSSVRGFQMRHAPNVPICVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMES
TGLPYRIHVSRSTVQTLRSLDKGYKIDIRGQIEIKGKGMEETYWLVGKAGFPRPLPTPLD
IKPGDPWQDLINQEIRVAFAEVRQCLAGPLSSGKAMAGP
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgaagcagttcccaggcaggagtctctggaagctgaagggcagcaggagtggtgactgc
acaggcggtggtggcagtgggagctccccaggccagagcctgtttgaagagtttgatgcc
cgagggccctggtgcaagaaccttaggatccacaaagaggcagtgagtcagccccaaatg
cacaacatggcaggactgcaggggtgcttgtaccctgaaggttggtactggacgctgcca
cgcagaaagacctgcctgccctgccaggtcccatgggggtctactctcagccattcaaga
actgtcccttccctacctcttctctctgtggtgctttggggtgccctcctgtgggctggc
tctctccccgatcttgtctggggggcaaggaccttcaccgtgggggtactgggtccctgg
gactgtgacccaatctttgcccaggctatccccagtgctgctgcccaactggctgtggac
cgagccaatcaggactcctcgctgatgctgagcttgcagctggcttccgtggtcctcccc
acaggctgtgatacccctcacgccctgaccacattcctggcccacaagaacacagtagcc
gcttttgtgggtcctgtcaatcctggttactgcccagcagcagccttgctggcccaaggt
tgggacaagaccctcttctcctgggcatgtggggctccagagggaggcggtaacctggtg
cccaccttgccttcagctgcccatgtgctgctgtctatcatgagacactttggctgggct
cgcgtggccattgtgtcctctcaccaggacatctgggtggctacggccagagaggtagcc
atgactctcaggacacacgggctgcctgtggagctggtgacctctctgggacccggggag
cagggagccacggaagtcctgaagcagctctgcagcatagacggcttgaaaatcgtggtg
ctatgcatgcactcagcgctcctgggtggctccgagcagacggccctgctgaggcgagca
tgggcccagggcctggcagacggaaggcttgtcttcttgccctatgacaccatgctcttc
tccttgccttaccacaaccgctcctaccccgccctcggccacatgggacccctgcgagaa
gtctatgacgcagtgctcaccatcagcctggagtctagtcccacggataaggccttcgaa
gctgctggagccaatgaaaaggtggctgtccacttggagacagagcaggtgtccccgctt
tttggaaccatctatgatgctgttgtcctgctggcccatgccctgaaccgctctgaaagc
catggggcagggctcttgggggcccacttaggggaccacataggggctctggatgtagct
ggctttagccagaggatccggacagatgagaagggcaggaggctggctcagtacgtcatt
ttggacacagatggtcaagaaagccaactggtccccacccacatcttagacactggcaca
tggcaagtgcagcccctgggcagggccatacactttccaggaggggcccctccagcacgt
gactccagctgctggtttgaccccaatacgctgtgcatgagaggtacgcagcccccaggc
agcctccttgctgtggccctggcctgtgtcctggtgctgaccggcggggccctcatttgc
ctcatcagagtgggcatccagcagctgcagctggcgagggggccccacaggatcctgctg
acagcccaggagctcactttcatccatcaggccctaagcagacgaaggctgcatgtggac
agtgcaagtgaatcaagaagtgcaatggatggtggaagcctgaggtcagtgtcccaaggg
tcagcaagaagcctgccagcaccccaggagcctaccaatgtggctctttaccagggagag
tgggtatggctgaagaagtttgaagctggcacagccctggagctgcggccagactgcctc
agcctcctgagaaagatgcgagagcttcggcatgataatgttgccacctgcctgggcttc
ttcacggcccccgggatcagtgctctggtgctggagcactgtgcccgaggcagcttggag
gacctgctgcggaatgaggctctgcggctggactggactttcaaggcctccctgctactg
gatttgatccaaggcgtgcggtatctgcaccatcgacatttcccgcatggacgcctcaag
tcccgaaactgtgtggtggatggccgctttgtgctaaaggtcacagaccatggttatgca
gagctcctggacgctcagcgggctccccgccccccgccagtcccagaagagttgctgtgg
acggctccggagctgctgcgggaccctgggaggggcaccctcaaaggagacgtcttcagc
attggcatcatcctgcaggaggtgctgactcgagggccaccctatggttcttcagggctc
tcagcagaagaaatcatcagaaaggtggcatcaccccctcccctgtgccggccacgggtg
tcccctgaccatgggccacccgaatgcatccagctgatggagcagtgctgggaggaggct
ccggaacatagacccagcctggaccagatctacactcagttcaaaagcatcaaccaaggc
aagaaaaccagtgttgctgactctatgctacggatgttggaaaagtattcccagaacctg
gaggacttgattcaggagcggactgaggaactggagctagagaggcagaagacagaaagg
ctgctctctcagatgctccctccgtctgtggccaaagctctgaaaatggggatgactgtg
gaaccggagtactttgaccaggttaccatttacttcagtgacatcgtggggtttactacc
atcgcagctctgagtgagcccatcgaggtagtgggcttgctcaatgacctctacacgctg
tttgatgctgttctgggcagccatgacgtgtataaggtggagaccattggggacgcctac
atggtggcatcagggctgccccggcgcaacgggaaccggcacgcggcagagattgccaac
atggccctggacatcctcagctccgtacggggctttcagatgaggcatgcgcccaatgtg
cccatttgcgtcagggctggcctgcactcagggccctgtgtggcgggggtcgtgggtctc
accatgcctcggtactgcctctttggggacaccgttaacactgcatcccggatggagtcc
acagggctaccatacagaattcatgtcagcagaagcactgtccagacactgcgcagcctg
gataaaggctacaaaattgacatcagaggccagattgagataaaggggaagggcatggag
gagacctactggctggtggggaaagcaggcttccccagacccctccccacacctctggac
atcaaacctggggacccctggcaggacctcataaaccaagaaatcagggtagcctttgcc
gaagtccgccagtgcttggctgggcctttgagctcagggaaggccatggctgggccctga

DBGET integrated database retrieval system