KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515689
Entry
107515689         CDS       T06036                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04071  Sphingolipid signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04137  Mitophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04216  Ferroptosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04722  Neurotrophin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515689 (TP53)
   04310 Wnt signaling pathway
    107515689 (TP53)
   04071 Sphingolipid signaling pathway
    107515689 (TP53)
   04151 PI3K-Akt signaling pathway
    107515689 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107515689 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    107515689 (TP53)
   04210 Apoptosis
    107515689 (TP53)
   04216 Ferroptosis
    107515689 (TP53)
   04115 p53 signaling pathway
    107515689 (TP53)
   04218 Cellular senescence
    107515689 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107515689 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107515689 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    107515689 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515689 (TP53)
   05202 Transcriptional misregulation in cancer
    107515689 (TP53)
   05206 MicroRNAs in cancer
    107515689 (TP53)
   05205 Proteoglycans in cancer
    107515689 (TP53)
   05203 Viral carcinogenesis
    107515689 (TP53)
   05230 Central carbon metabolism in cancer
    107515689 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107515689 (TP53)
   05212 Pancreatic cancer
    107515689 (TP53)
   05225 Hepatocellular carcinoma
    107515689 (TP53)
   05226 Gastric cancer
    107515689 (TP53)
   05214 Glioma
    107515689 (TP53)
   05216 Thyroid cancer
    107515689 (TP53)
   05220 Chronic myeloid leukemia
    107515689 (TP53)
   05217 Basal cell carcinoma
    107515689 (TP53)
   05218 Melanoma
    107515689 (TP53)
   05219 Bladder cancer
    107515689 (TP53)
   05215 Prostate cancer
    107515689 (TP53)
   05213 Endometrial cancer
    107515689 (TP53)
   05224 Breast cancer
    107515689 (TP53)
   05222 Small cell lung cancer
    107515689 (TP53)
   05223 Non-small cell lung cancer
    107515689 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107515689 (TP53)
   05014 Amyotrophic lateral sclerosis
    107515689 (TP53)
   05016 Huntington disease
    107515689 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107515689 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515689 (TP53)
   05161 Hepatitis B
    107515689 (TP53)
   05160 Hepatitis C
    107515689 (TP53)
   05162 Measles
    107515689 (TP53)
   05168 Herpes simplex virus 1 infection
    107515689 (TP53)
   05163 Human cytomegalovirus infection
    107515689 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515689 (TP53)
   05169 Epstein-Barr virus infection
    107515689 (TP53)
   05165 Human papillomavirus infection
    107515689 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107515689 (TP53)
   01522 Endocrine resistance
    107515689 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107515689 (TP53)
   03036 Chromosome and associated proteins [BR:ray03036]
    107515689 (TP53)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107515689 (TP53)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107515689 (TP53)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107515689 (TP53)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107515689 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 107515689
NCBI-ProteinID: XP_016010258
LinkDB
Position
Unknown
AA seq 383 aa
MDMPQSELNMEAPLSQETFSDLWKLLPQNNVLPPDISLPVDEFLLPPDLVNWLDEDRNES
PRGPTTSTTIAATPAPAISWPLSSFVPSQKTYPGCYDFRLGFLNSGTAKSVTCTYSPTLN
KLFCQLAKTCPVQLWVSSPPPLGARVRAMAIYKKSEHMTEVVRRCPHHERCSDYSDGLAP
PQHLIRVEGNLRAEYLDDKNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGMNRRP
ILTIITLEDSSGNLLGRNIFEVRVCACPGRDRRTEEENFQNKGKPCPKQPPGSTKRALPT
NTTSSSPSPKMPLDEEYFTLQIRGRKNFEMLRELNEALELKDAQAGKEPRGSRAHSSHLK
SKKGQSTSCHKKLMLKTEGPDSD
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatatgcctcagtcagaactcaatatggaggcccctctgagtcaggagacattttca
gacttgtggaaactacttcctcaaaacaacgttctgccccccgacatatccctgccagtg
gatgaatttctgctgcccccagaccttgtgaactggctggatgaagatcgaaatgaatcc
cccaggggcccaacaacttctacaacaatagctgccaccccagcacctgccatctcctgg
cccttgtcatcctttgtcccttcccagaagacctaccctggctgctatgattttcgttta
ggattcctgaattctgggacagccaagtcggtaacctgcacgtactctcctaccctcaac
aagctattttgccagctagcaaagacctgccctgtgcagctctgggtcagctccccgccc
ccgctgggcgcccgtgtccgagctatggccatctacaagaaatctgagcacatgacagag
gtggtgaggcgctgccctcaccatgagcgctgctctgactatagtgatggtctggcccct
cctcagcatcttatccgggtggaagggaatttgcgtgctgagtatttggatgacaaaaac
acttttcgacatagtgtggtggtgccctacgagccacctgaggtgggctctgattgtact
actatccactacaacttcatgtgtaatagctcctgcatgggcggcatgaaccggcggccc
atcctcaccatcatcacactggaagactccagtggtaatctgctgggacggaacatcttt
gaggtacgtgtttgtgcctgtcctgggagagatcggcgcacagaggaagagaatttccaa
aacaagggtaaaccttgtcccaaacagccccctgggagcactaagcgagcactgcccacc
aataccaccagctcctctccctcaccaaagatgccattggatgaagaatatttcactctt
cagatccgtggacgtaaaaacttcgagatgttacgagaactgaatgaagccttagagctg
aaggatgctcaggctggaaaggagcccaggggaagcagggctcactccagccacttgaag
tctaagaaggggcagtctacctcctgccataaaaaactcatgctcaagacagaggggcct
gactcagattga

DBGET integrated database retrieval system