KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515723
Entry
107515723         CDS       T06036                                 

Gene name
PPARGC1A
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma coactivator 1-alpha isoform X1
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04371  Apelin signaling pathway
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107515723 (PPARGC1A)
   04152 AMPK signaling pathway
    107515723 (PPARGC1A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107515723 (PPARGC1A)
   04922 Glucagon signaling pathway
    107515723 (PPARGC1A)
   04920 Adipocytokine signaling pathway
    107515723 (PPARGC1A)
  09149 Aging
   04211 Longevity regulating pathway
    107515723 (PPARGC1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    107515723 (PPARGC1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107515723 (PPARGC1A)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107515723 (PPARGC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ray03029]
    107515723 (PPARGC1A)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    107515723 (PPARGC1A)
SSDB
Motif
Pfam: RRM_1 Tox-ODYAM1
Other DBs
NCBI-GeneID: 107515723
NCBI-ProteinID: XP_016010307
LinkDB
Position
Unknown
AA seq 842 aa
MDETSPRLEEDWKKGLQREASWQCAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGL
KWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDG
DVTTENEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHR
IRTNPAVVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHAKPTETRNSSRDK
CTSKKKSHTQSQSQHLQAKPTTLSLPLTPESPNDTKGSPFENKTIERTLSVELSGTAGLT
PPTTPPHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESPSTQGNNSTKKGPEQSELY
AQLSKTSVLTSGHEERKAKRPSLRLFGDHDYCQSLNSKTEILINISQELQDSRQLEYKDA
SSSWQGQICSSTDSDKCYMRETLEAGKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFD
DEADKTRELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLNYPWDGTQSYSLFD
VSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRS
SSRSCYYYESSHCRHRSHRNSPLCSRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYE
KRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGD
SYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLGMDFIVHEMRN
PYVELKMEANVNHRHNGVDHYFIFCRDYSNTNFIAQRAFRSKGHRFCQQGPEVNSLSCLP
RC
NT seq 2529 nt   +upstreamnt  +downstreamnt
atggatgagacctcccccaggctggaagaagactggaaaaaaggacttcagcgagaagca
agctggcagtgtgctgctttggttggtgaagaccagcctctttgcccagatcttcctgaa
cttgacctttctgaactagacgtgaacgacttggatacagacagctttctgggtggactc
aagtggtgcagtgaccaatcggaaataatatccaatcagtacaacaatgagccttcaaac
atatttgagaagatagatgaagagaatgaggcgaacttgctagcagtcctcacagagaca
ctggacagtctccctgtggatgaagacggattgccctcatttgatgcactgacagatgga
gatgtgaccaccgagaatgaggctagtccttcctccatgcctgacggcacccctccgcct
caggaggcagaagagccgtctctacttaagaagctgttactggcaccggccaacactcag
ctaagttataatgaatgcagtggtctcagtacccagaaccatgcaaatcataatcacagg
atcagaacaaaccctgcagttgttaagaccgagaattcatggagcaataaagcgaagagc
atttgtcaacagcaaaagccgcaaagacgtccctgctcagagcttctcaagtatctgacc
acaaacgatgaccctcctcacgcgaaacccacagagaccaggaacagcagcagagacaaa
tgcacctccaaaaagaagtcccacacacagtcacagtcgcaacatttacaagccaaacca
acaactttatctcttcctctgaccccagagtcaccaaatgacaccaagggttccccattt
gagaacaagactattgaacgaaccttaagtgtggaactctctggaactgcaggcctaact
ccacccacaactcctcctcataaagccaaccaagacaaccctttcagggcttctccaaag
ctgaagtcctcttgcaagactgtggtacctccgccatcaaagaagccccggtacagcgag
tctcctagtacccaaggcaataactccaccaagaaagggcccgagcagtctgagttgtat
gcacaactcagcaagacctcagtgctcaccagcggacacgaggaaaggaaggccaagcgg
cccagtctacggctgtttggtgaccatgactattgtcagtcactcaattccaaaacggaa
atactcattaatatatcacaggagctccaagactctagacaactagaatataaagatgct
tcctccagttggcaggggcagatttgttcttccacagattcagacaagtgctacatgaga
gagactttggaggcgggcaagcaggtctctccttgcagcaccagaaaacagctccaagac
caggaaatccgagctgagctgaacaagcacttcggtcatcccagtcaagctgtttttgac
gacgaagcagacaagaccagagaactgagggacagtgatttcagtaacgaacaattctcc
aaactacctatgtttataaattcaggactagccatggatggcctgtttgatgacagcgaa
gatgaaagtgataaactgaactacccttgggatggcacgcaatcctattcattgtttgat
gtgtcgccttcctgctcttcttttaactctccatgtagagattccgtgtcaccacccaaa
tccttattttctcaaagaccccaaaggatgcgctctcgttcaaggtccttttctcgacac
aggtcgtgttcccgatcaccatattccaggtcaagatcaagatccccaggcagtagatcc
tcttcaagatcttgctactactatgagtcaagccactgcagacaccgttcacaccgaaac
tctcccctgtgctcgagatcgcgttcaagatcaccctacagccgtaggcccaggtatgac
agctacgaggaatatcagcacgaaaggctgaagagggaagaataccgcagagagtatgag
aagcgagaatctgaaagggccaaacagagggagaggcagaggcagaaggcaattgaagaa
cgccgtgtgatatatgttggtaaaatcagacctgacacaacacggacagaactgagggac
cgttttgaagtttttggtgaaattgaggagtgcacagtaaatctacgggatgatggagac
agctatggtttcattacctaccgttatacctgtgatgctttcgctgctcttgaaaatgga
tacactttgcgcaggtcaaatgaaactgacttcgagctgtacttttgtggacgcaagcaa
tttttcaagtctaactatgcagacctaggtatggattttattgtacatgaaatgaggaat
ccatatgtagagctcaaaatggaagcaaatgtaaaccataggcacaacggggtggaccat
tattttattttctgcagggactattcgaatacaaatttcatcgcccaaagggcattcaga
agcaaggggcataggttttgtcaacaagggccagaagtcaattcattgtcctgtcttccc
agatgctga

DBGET integrated database retrieval system