KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515755
Entry
107515755         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal acetylcholine receptor subunit alpha-7-like
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05033  Nicotine addiction
ray05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515755
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515755
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107515755
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107515755
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107515755
   05022 Pathways of neurodegeneration - multiple diseases
    107515755
  09165 Substance dependence
   05033 Nicotine addiction
    107515755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515755
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107515755
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF2417
Other DBs
NCBI-GeneID: 107515755
NCBI-ProteinID: XP_016010356
LinkDB
Position
Unknown
AA seq 494 aa
MRRPLWLALAASLLHATRQGEFQRKLYRELVKNYNPLERPVANDTQPLTVYFSLSLLQIM
DVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKTVRFPDSQIWKPDILLYNSADERFD
ATFHTNVLVNSSGHCQYLPPGIFKSSCSIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ
EADTSGYITNGEWDLMGVPGKRSENFYECCQEPYPDVTFTVTIRRRTLYYGLNLLVPCVL
ISSLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMVI
VGLSVVVTVIVLQYHHHDPDGGKMPKWTRVVLLNWCAWFLRMKRPGEERVRPACQLARRR
GSLASVDLGAGPAPPAANGDLLYLGFRGLDAVRCGPAPDVGALCGRLACSXAARAGTGPD
GDPDLARILDEVRYLAARFRRQDESAARGSEWKFAACVVDRLCLMAFSVFTVLCTVGILM
SAPNFVDAVSKDFA
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcgccgcccgctgtggctggcgctggccgcgtcgctgctgcacgcgacccggcaaggc
gagttccagaggaagctgtacagggagctggtcaagaactacaacccgctggagaggccg
gtggccaacgacacgcagccgctcaccgtctacttctcgctgagcctcctgcagatcatg
gacgtggatgagaagaatcaagttctaaccaccaacatttggctgcaaatgtactggaca
gaccactacctgcagtggaacgtgtcggagtacccgggcgtgaagaccgtgcgcttcccg
gacagccagatctggaagccggacatccttctctacaacagtgccgatgagagattcgac
gccaccttccacacgaacgtgctggtgaactcctccgggcattgccagtacctcccccca
ggcatcttcaagagctcctgctccatcgacgtgcgctggttccccttcgacgtgcagcac
tgcaagctcaagttcgggtcctggtcgtatggggggtggtcgctggacctgcagatgcag
gaggcggacaccagcggctacatcaccaacggcgagtgggacctcatgggggtccccggc
aagcggagcgagaatttctacgagtgctgccaggagccgtacccggacgtcaccttcacg
gtgaccatccgccgcaggacgctgtactacggcctcaacctgctcgtcccctgtgtgctc
atctcgtccctggccctgctggtcttcctgctgcccgcggactccggggagaagatctcc
ctcgggatcacggtgctgctgtccctcaccgtcttcatgctgctggtggctgagatcatg
cccgcgacgtccgactcggtgcccctgatcgcccagtacttcgccagcaccatggtcatc
gtgggcctgtccgtggtcgtcacggtcatcgtgctgcagtaccaccaccacgaccccgac
ggcggcaagatgcccaagtggaccagggtcgtcctgctgaactggtgcgcctggttcctg
cgcatgaagcggccgggcgaggagcgcgtgcggccggcctgccagctcgcgcggcgccgc
ggcagcctggccagcgtggacctgggcgcggggcccgcgccgcccgccgccaacggcgac
ctgctctacctgggcttccgcggcctggacgccgtgcgctgcggcccggcgcccgacgtg
ggcgcgctgtgcggccgcctggcctgctcgnncgccgcgcgcgcgggcacgggccccgac
ggcgacccggacctggcgcgcatcctggacgaggtgcgctacctggccgcgcgcttccgc
cgccaggacgagagcgcggcgcggggcagcgagtggaagttcgcggcgtgcgtggtggac
cgcctgtgcctcatggccttctccgtgttcaccgtgctctgcaccgtgggcatcctcatg
tccgcgcccaacttcgtggacgccgtgtccaaggacttcgcgtga

DBGET integrated database retrieval system