KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515774
Entry
107515774         CDS       T06036                                 

Gene name
TJP1
Definition
(RefSeq) tight junction protein ZO-1 isoform X1
  KO
K05701  tight junction protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04520  Adherens junction
ray04530  Tight junction
ray04540  Gap junction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107515774 (TJP1)
   04530 Tight junction
    107515774 (TJP1)
   04540 Gap junction
    107515774 (TJP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107515774 (TJP1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107515774 (TJP1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1
Other DBs
NCBI-GeneID: 107515774
NCBI-ProteinID: XP_016010375
LinkDB
Position
Unknown
AA seq 1701 aa
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEN
DRVAMVNGVSMDNVEHAFAVQQLRRSGKTAKITIRRKKKVQIPVSRPDPEPASENEEDSY
DEDVHDARRGRAGVAARRSEKSWARDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKS
RKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERS
KGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRHSR
SRSPDQRSEPSDHSRHSPQQPSNGSLRSREEERVSKPGTVSTPVKHSEDHTPKAADEVTA
ERSEKQAPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDS
VGLRLAGGNDVGIFVAGVLEESPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPK
GEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNG
KLGSWLAIRIGKNHKEVERGIIPSKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKR
NLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIA
KSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDS
KQGVKMMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSLNDGWYGALKEAVQQ
QQSQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGA
YTDQELDETLNDEVGTPPESAITRSSEPVTEDSSGMHHESQTHPPYPPQAQPQPAHRVDS
PGLKTASQQVYRKDPCPEDVTRQTLVLKQPAGSHAGQRPDKGPRVSYDTAPQHAAEQAGR
GLEQPPYRYDSSGCPDPLSQSLAPRLRYEERVPAYEDRVPAYEDRWAYHDDRQPPPPRPA
FESQPLRDLDARQHPDEPSERGYFPRFEEPAPLSYDSRLRYDQPLRTSTLRHEEPPAPGY
DLHHRYWAEAQPCSSAGPRASEPKQYYDQYVRSYEQVPAQAFGPAAGPPEPLHAAAAVPP
LVAGSQQKPEGLPVSTKPLPPPPAVTEEEEDPAMKPQSVLTRVKMFENKRSVSLESKKDE
NHTAGFKPPEIASKPPGVPFAGPKSTQNQFSEHDKTLYRIPEPQKPQPKPPEDIVRSNHY
DPEDDEEYYRKQLSYFDRRGFEHKPSTLTPASQLSEPATPVHSQGQPNFSSYSSKCLGFH
TSCDCLRRSVKWGKSPEADAMDRSFGEKRYDPVQATPPPPPLPAQYAQAPQPGSASSLAL
HTHARGAHGEGNALSLDFQNSLVSKPDAPPPQSKPTALRAPGRDDAAQATFHPQRSFPDR
APAGAAEQAPRTGAPAYSRFTPKPYTAAARPFERKFDSPKFSHNLLPSEATHKPDVSSKA
PTSPKMLGKAHGSAQPLEFDSGVETFSVRAEKPRYQANNVSSVPRAVPVSPSAVDEDAEE
DGHTVVATARGVFSSNGGVLSSIETGVSIIIPQGAIPDGVEQEIYFKVCRDNSILPPLDK
EKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKC
LPGDPNYLVGANCVSVLIDHF
NT seq 5106 nt   +upstreamnt  +downstreamnt
atggaggaaacggctatatgggagcagcacacggtgacgcttcacagggctcctggtttt
ggatttggaatcgctatatccggtggcagagataacccgcattttcagagtggggaaacc
tcaatcgtgatctcagacgtcctgaagggggggcccgccgagggccagctgcaggagaat
gaccgtgtcgcgatggttaatggagtgtcgatggataacgtcgagcatgctttcgccgtt
cagcagctaaggagaagtgggaagactgcgaaaatcaccattcggaggaagaagaaagtg
cagataccagtaagtcgtccggacccagagccagcgtctgagaatgaggaggacagttac
gacgaggacgtccatgacgcccgcaggggccgcgccggcgtggctgcccgaaggagcgag
aagagctgggcgagggacagaagtgccagcagagagaggagtctgtccccgcggtctgac
aggcggtctgtggcctccagtcaacccgccaagcccaccaaagtcacattggtgaaatcc
cggaaaaatgaagagtacggccttcgactggccagccacatatttgtaaaggaaatttca
caagacagcttggcggcaagagacggcaacattcaagaaggcgacgtcgtgctgaagata
aatgggaccgtgacagaaaacatgtcgctgacagatgcaaaaacgttgatagaaaggtct
aaaggcaagttgaaaatggtcgttcagagagacgagcgggccacgctgctcaacgtcccg
gacctgtctgacagcatccactccgccaacgcctcggagagggacgacatttcagaaatt
cagtcactggcatcagatcattctggtcgctcacacgacaggcctccccgccacagccgg
tctcggtcacctgaccagcggtctgagccctctgatcactccagacactctccgcagcag
cccagcaatggcagtctccggagcagggaggaggagagagtttcgaagcccgggaccgtc
tcgactccggtgaagcactcggaggaccacacacccaaggctgcggacgaagtcacggcg
gagcggagcgagaagcaagcgccctctcttcccgagccaaagcctgtgtatgctcaagtt
ggacagccagacgtggatttacctgtcagtccatctgatggtgtcctccccaattcaact
cacgaagacgggattctccggcccagcatgaaattggtgaaattcagaaaaggagacagt
gtgggtttgcggctggctggtggaaacgacgtcgggatatttgtcgctggcgttctggaa
gagagccctgcggccaaagaaggcctggaggagggcgaccagattctcagggtaaacaac
gtagacttcacaaacatcataagggaggaggccgtgctgttcctgctcgacctccctaaa
ggggaggaggtgaccatcctggcgcagaagaagaaggatgtttatcgtcgcatcgtagaa
tcggatgtaggagattccttctatattagaacccattttgaatatgagaaggaatctccg
tacggacttagttttaacaaaggagaggtgttccgggtcgtggacaccttgtacaatggg
aaactgggctcctggctcgccattcgcatcggcaagaaccacaaggaggtggaacgaggc
atcatccccagtaagaacagagccgagcagctggccagtgttcagtacacgctccccaaa
actgccggcggagaccgggctgacttctggcggttccggggtctgcgcagctccaagaga
aatcttcggaaaagcagagaggatttgtcggctcagcctgttcaaaccaagtttccagcc
tacgaaagagttgttcttcgcgaagctggattcctgaggcccgtgacaatcttcggaccg
atagctgacgttgcaagagagaagctggcgcgggaagagcccgacatctatcagatcgca
aaaagtgaaccgcgagatgccggcactgaccagcgtagctctggcattattcgtcttcat
acaataaagcagataattgatcaagacaaacatgctttattagacgtgacaccgaacgca
gttgatcgcctgaattatgcccagtggtacccgattgttgtatttctcaaccctgattct
aagcaaggtgtgaagatgatgagaatgaggttatgtccagaatcgcggaaaagcgccagg
aaattatacgagcggtctcacaagcttcgtaaaaataatcaccatctttttacaactacg
attaacttgaactcgctgaacgacggctggtacggtgccctgaaggaagcggtccagcag
cagcagagccagctggtgtgggtttccgaggggaaggcggacggtgctacaagtgatgac
cttgatttgcatgacgatcgtctgtcctacctgtcagccccaggtagtgaatactcaatg
tatagcacggacagtagacacacttctgactatgaagacacagatacagaaggcggggcc
tacactgatcaagaactagacgaaactcttaacgatgaggttgggactccaccggagtct
gccattacacggtcctctgagcccgtgacagaggactcctctgggatgcaccacgagagc
cagacacaccctccttacccaccacaggcgcagccacagccagcccatagagtagactcc
cctggacttaaaactgcctctcaacaggtgtacaggaaggacccctgtcccgaggacgtg
acgaggcagaccctcgttctaaagcagccagccggcagccacgccgggcagaggccggac
aaggggccccgtgtgagctacgacactgccccccagcacgcagcggagcaggccggccgg
ggcctggagcagccgccgtatagatacgactcctcgggctgtccggacccgctttcccag
agcctggccccgcgcctgcgctacgaggagcgtgtgcccgcctacgaggaccgcgtcccc
gcctacgaggatcgctgggcgtaccacgatgacaggcagcccccgccgcctcggccggcc
ttcgagagtcagcccctgcgagacctcgacgccaggcagcaccctgacgagccctcggag
cgaggatacttcccccggttcgaagagccagcccctctgtcctacgacagccggctgcgc
tatgaccagccactgaggacctccaccctacgacacgaggagccaccggctccggggtac
gacctgcaccacagatactgggcagaggcgcagccctgctcctcagcgggccctcgggcg
tccgagcccaagcagtattacgaccagtacgtgcgcagttatgagcaggtcccggcccag
gccttcggccccgcggcaggcccccccgagcctctccacgctgccgcggctgtcccgcct
ctcgtagctgggtctcagcagaagccagaaggtctgcctgtgagtaccaagccactgccg
ccacccccagctgtaactgaggaagaggaggacccggccatgaagccgcagtctgtgctc
acaagggtgaaaatgtttgaaaacaaaaggtcagtgtcgttggagagcaagaaggacgag
aaccacactgctgggttcaagcctccagagatagcgtctaaacctccaggtgttcccttc
gctggtcccaagtccactcagaatcagttcagtgaacacgacaaaacgctgtacaggatc
ccagaacctcagaaacctcagccgaagccaccggaagacatcgtgcggtcaaaccactac
gaccccgaggatgacgaggagtattaccggaaacagctctcgtacttcgatcgaagaggc
ttcgagcacaagccttccacgctcacccctgctagccagctctcggagcctgccacgccc
gtgcattctcaggggcagcctaacttttccagttactcttcaaaatgtcttggctttcac
actagctgtgactgcttgagaaggagcgtcaagtggggaaagtcgcctgaagctgatgct
atggataggtcgtttggcgagaaacgctatgaccccgtgcaagccacgcccccgccgcct
ccgttgcctgcccagtacgcccaggcgccccagcccggctccgcctcttccctcgccctc
cacacccacgccaggggggcccatggcgaaggcaatgccctgtcattggatttccagaat
tcccttgtgtccaagccagatgcacctccgcctcagagcaagcccacagctctcagggcg
ccgggccgggacgacgccgcgcaggccaccttccacccgcagaggagcttcccggacaga
gcaccggccggcgcggccgagcaggcgccgagaacgggcgccccggcctacagccgcttc
acgcccaagccctacaccgcggccgcgcggccgttcgaacgcaagtttgacagcccgaaa
ttcagtcacaaccttctgccaagcgaagccacgcacaaacctgatgtctcttccaaagcc
cccacgtctccaaaaatgctggggaaggcgcacggctcggcacagccgctcgagttcgac
agtggcgtcgagacgttctccgtccgggcggagaagcccaggtaccaagcgaacaacgtc
agctcagtgcccagagccgtcccggtgagtccctcagctgtggacgaggacgccgaggag
gacgggcacaccgtggtggccacggcccggggcgtgttcagcagcaacggcggggtcctg
agctccatcgagacaggcgtcagcatcatcatcccccagggggccatccctgacggcgtg
gagcaggaaatctacttcaaggtctgccgggacaacagcatcctgccgcccctggacaag
gagaaaggcgagacgctgctgagcccgctggtgatgtgcgggccccacggcctcaagttc
ctgaagcccgtggagctgcgcctgccacactgtgcgtccatgactcctgacggttggtct
tttgctctaaaatcatccgactcctcgtcgggtgaccccaaaacctggcaaaacaagtgt
cttcctggagacccaaattaccttgtcggagcaaactgtgtttctgtcctgatcgaccac
ttctag

DBGET integrated database retrieval system