KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515961
Entry
107515961         CDS       T06036                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04520  Adherens junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04714  Thermogenesis
ray04810  Regulation of actin cytoskeleton
ray04928  Parathyroid hormone synthesis, secretion and action
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05215  Prostate cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515961 (FGFR1)
   04014 Ras signaling pathway
    107515961 (FGFR1)
   04015 Rap1 signaling pathway
    107515961 (FGFR1)
   04020 Calcium signaling pathway
    107515961 (FGFR1)
   04151 PI3K-Akt signaling pathway
    107515961 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107515961 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107515961 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107515961 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107515961 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107515961 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515961 (FGFR1)
   05205 Proteoglycans in cancer
    107515961 (FGFR1)
   05230 Central carbon metabolism in cancer
    107515961 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    107515961 (FGFR1)
   05215 Prostate cancer
    107515961 (FGFR1)
   05224 Breast cancer
    107515961 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515961 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107515961 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107515961 (FGFR1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107515961 (FGFR1)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   107515961 (FGFR1)
CD molecules [BR:ray04090]
 Proteins
  107515961 (FGFR1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107515961 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 FGFR3_TM V-set Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 107515961
NCBI-ProteinID: XP_016010748
LinkDB
Position
Unknown
AA seq 822 aa
MWSWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSVPTDSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactctgcact
gccaggccagctccaaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gagtccttcctggtccaccctggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtccagagcatcaactggctgcgggacggggtacagctggtggaaagcaaccgtacccgc
atcacaggggaagaggtggaggtgcgggattccgtgcctaccgattctggcctctacgct
tgtgtgaccagcagcccctcaggcagcgacaccacctacttctccgtcaatgtctcagat
gctctcccttcctcagaggatgatgatgacgatgatgactcctcttcagaggagaaggaa
acagataacaccaaaccaaaccgtatgcccgtggctccatactggacgtccccagaaaag
atggagaaaaaactgcatgcagtgccagctgccaagacagtgaagtttaaatgcccttcc
agtgggactcctaaccccacactgcgctggctgaaaaatggcaaggagtttaaacctgac
cacaggattggcggctataaggtccgttatgccacctggagtatcataatggactccgtc
gtgccttctgacaagggcaattacacctgcatcgtggagaatgagtatggcagcatcaac
catacctaccagcttgatgtcgtggagcggtcccctcaccggcccatcctgcaggcaggg
ttgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agtgacccacagccccacatccagtggctaaagcacatcgaggtgaatgggagtaagatt
ggtccagacaacctgccttatgtccagatcttgaagactgccggagttaataccaccgac
aaagagatggaagtgcttcacttaaggaatgtctcctttgaggacgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcattctgcatggttgaccgttctggaa
gccctggaggagagaccggcggtgatgacctcacccctgtacctggagatcatcatctac
tgcacaggggccttcctcatctcctgcatggtggggtctgtcatcatctacaagatgaag
agtggcactaagaagagtgacttccacagccagatggccgtgcacaagctggccaagagc
attcctctgcgcagacaggtaacagtgtcggctgactcgagtgcatccatgaactctggg
gttctgctggtccggccctcacgtctctcctccagtggcaccccaatgctggctggggtt
tctgaatatgagcttcccgaagacccccgctgggagctgcctcgagacagactggtttta
ggcaaacccctaggagagggctgctttgggcaggtggtgttggcggaggccattgggctg
gacaaggacaaacccaatcgtgtgaccaaagtggctgtgaagatgttgaagtcggatgca
acagagaaagacctgtcagacctgatctcagaaatggaaatgatgaagatgatcgggaaa
cacaagaacatcatcaacctgctgggggcctgcacacaggacggtcctttgtacgtcatc
gtggagtatgcctccaagggcaacctacgggagtacctgcaggcccggaggcctcctggg
ctggaatactgttacaatcccagccacaacccagaggagcagctctcctccaaggacctg
gtatcctgtgcctatcaggtggcccgaggcatggaatatctcgcctccaaaaagtgcata
caccgagacctggccgccaggaatgtcctggtgacggaggacaatgtgatgaagatcgca
gactttggcctagctcgagacattcaccacatcgactactacaaaaagacaaccaatggc
cgactgcctgttaagtggatggcacccgaggcattgttcgaccggatctacacccaccag
agtgatgtgtggtcttttggggtgcttctgtgggaaatcttcactctgggtggctcccca
tatcctggcgtgcctgtggaggagcttttcaagctgctgaaggagggtcatcgtatggac
aagcccagtaactgcaccaatgaactgtacatgatgatgcgggattgttggcacgcagta
ccctctcaaagacctaccttcaagcagctggtagaagatctggaccgcatcgtggccttg
acctccaatcaggagtatctggacctgtcaatgcccctggaccaatactctcctagcttt
cctgacacccgaagctctacctgctcctcaggggaggattctgtcttctctcatgagccg
ttgcctgaggagccctgtctgccccgacacccagcccagcttgccaatggcggactcaaa
cgacgctga

DBGET integrated database retrieval system