KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515968
Entry
107515968         CDS       T06036                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray03013  RNA transport
ray04012  ErbB signaling pathway
ray04066  HIF-1 signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04218  Cellular senescence
ray04910  Insulin signaling pathway
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05168  Herpes simplex virus 1 infection
ray05221  Acute myeloid leukemia
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107515968 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107515968 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    107515968 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    107515968 (EIF4EBP1)
   04152 AMPK signaling pathway
    107515968 (EIF4EBP1)
   04150 mTOR signaling pathway
    107515968 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107515968 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107515968 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    107515968 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107515968 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107515968 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107515968 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    107515968 (EIF4EBP1)
   05165 Human papillomavirus infection
    107515968 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107515968 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107515968 (EIF4EBP1)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     107515968 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 107515968
NCBI-ProteinID: XP_016010776
LinkDB
Position
Unknown
AA seq 118 aa
MSGGSSCSQTPSQAIPATRRVVLSDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPVIPGVTSPASDEPPTEACQNHLRNSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtcgggcggcagcagctgcagccagaccccaagccaggccatccccgccactcgccgg
gtggtcctaagcgacggcgtgcagctgccgcccggggactacagtaccacccccggcggc
acgctcttcagcaccaccccaggaggtaccaggatcatctatgaccgaaagttcctaatg
gagtgtcggaactcacctgtgaccaaaacacccccacgggacctgcccgtcattcctggg
gtcactagccctgccagcgatgagccccccacagaagcctgccagaaccacctgcgcaac
agcccagaagataagcctgcaggtggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system