KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515989
Entry
107515989         CDS       T06036                                 

Gene name
VASP
Definition
(RefSeq) vasodilator-stimulated phosphoprotein isoform X1
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04510  Focal adhesion
ray04530  Tight junction
ray04611  Platelet activation
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107515989 (VASP)
   04022 cGMP-PKG signaling pathway
    107515989 (VASP)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107515989 (VASP)
   04530 Tight junction
    107515989 (VASP)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107515989 (VASP)
   04666 Fc gamma R-mediated phagocytosis
    107515989 (VASP)
   04670 Leukocyte transendothelial migration
    107515989 (VASP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107515989 (VASP)
   04147 Exosome [BR:ray04147]
    107515989 (VASP)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107515989 (VASP)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107515989 (VASP)
SSDB
Motif
Pfam: WH1 VASP_tetra ASD2 Ran_BP1
Other DBs
NCBI-GeneID: 107515989
NCBI-ProteinID: XP_016010802
LinkDB
Position
Unknown
AA seq 385 aa
MSETVVCSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANAFRVVGRKMQPDQQV
VINCSIIRGLKYNQATPNFHQWRDARQVWGLNFCSKEDAAQFAAGMASALEALEGGGPPA
PPPPPQPPAGPPAWSVQNGPSLEEAEQHKRQLEHVERERRVSNAGGPPAPPAGGPPPPPG
PPPPPGPPPPPGLPPSGVSAVGHGAGGGPPPPPPLPTAAGPSGSGTGAPGLAAAIAGAKL
RKVSKQEEASGGPSAPKAESSRSTGGGLMEEMNAMLARRRKATLVGEKPPKDESANQEEP
EARVPSHSEPVRRPWEKNSTTLPRMKSSSSMTASEAHPSTPSAADESDLERVKQELLEEV
RKELQKVKEEIIEAFVQELRKRGSP
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgagcgagacggttgtctgctccagccgggccactgtgatgctttacgatgacagcaac
aagcgttggctgcctgctggcaccggcccccaggccttcagccgagtccagatctaccac
aaccccacagccaatgccttccgcgtggtgggccggaaaatgcagcccgaccagcaggtg
gtcatcaactgctccatcatccggggtctcaagtacaatcaggccacgcccaacttccac
cagtggcgcgacgcccgccaggtctggggcctcaacttctgcagcaaagaggacgcggcc
cagtttgctgccggcatggccagcgccctagaggcattggaaggaggtgggcctccagca
ccaccaccaccacctcagccacctgcggggcctcctgcctggtctgtccagaatggtccc
tccctcgaggaggcggagcagcacaaaaggcagctggagcatgtggagcgggagcgccgg
gtctccaatgcaggaggcccgcctgctcccccagctgggggcccacccccacctccagga
cctcctcctcctccaggtccccccccaccccctggtctgcccccatcgggggtctcagct
gtggggcatggagcagggggaggcccaccccctccgccccctctccctacagcagcaggc
cccagtggtagtgggacgggggcccccggcctggctgcagccattgccggagccaaactc
aggaaagtcagcaagcaggaggaggcctcaggggggccctcagctcccaaagctgagagc
agtcgaagcacaggcggggggctcatggaggaaatgaacgccatgctggccaggagaagg
aaagccacactagttggtgagaaaccccccaaggatgaatctgccaatcaggaggagcca
gaagccagagtcccatctcacagtgaacctgtgcggagaccctgggagaagaacagcaca
accttgccaaggatgaagtcgtcgtcctccatgaccgcttccgaggcccacccctctaca
cccagcgctgctgatgagtcagacctagagagggtgaaacaggagcttctggaagaggtg
aggaaggagttacagaaagtgaaagaggaaataattgaagcctttgtccaggagctgagg
aagcggggttccccctga

DBGET integrated database retrieval system