KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516039
Entry
107516039         CDS       T06036                                 

Gene name
PTGIR
Definition
(RefSeq) prostacyclin receptor isoform X1
  KO
K04263  prostacyclin receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
ray04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107516039 (PTGIR)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107516039 (PTGIR)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516039 (PTGIR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107516039 (PTGIR)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Lipid
   Prostacyclin
    107516039 (PTGIR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107516039
NCBI-ProteinID: XP_016010924
LinkDB
Position
Unknown
AA seq 384 aa
MADSCRNLTYVRDSVGPATSTLMFVAGVVGNGLALGILGVRRASRPSAFAVLVTGLAVTD
LLGTCALSPAVFVAYARNSSLLGLARGRPELCDAFAFAMTFFGLASTLILFAMAVERCLA
LSHPYLYAQLDAPRCARLALPAVYAFCTLFCSLPLLGLGQHQQYCPGSWCFIRLRSADPG
GRAFSLAYASLVALLVAAIILCNGSVTLSLCRMYRQQRRHQGSLVPGPRRGEGEVDHLIL
LALMTVIMAVCSLPLTIRGFTQAITPDSSEMGDLLAFRFNAFNPILDPWVFILFRKAVFQ
RLKLWFCCCLCPGPARGHSQTPLSRPASGRKDPRAPATLGGKEGNWVPLSAWGEAQGGSA
AQRAGSSTVGTTSKAGSAAACSLC
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctgactcctgcaggaacctcacctacgtgcgggactcggtgggcccggcgacgagc
accctgatgtttgtggccggggtcgtgggcaacgggctggcgctgggcatcctgggcgtc
cggcgggcgtcacgcccatccgccttcgcggtgctggtcactgggttggcggtcacagac
ctgctgggcacttgtgccctgagcccggccgtgttcgtggcctacgcccgcaacagctca
ctcctgggcctggcccggggccgcccggagctgtgtgacgccttcgcgttcgccatgacc
ttctttggtctggcctccacgctcatcctcttcgccatggccgtggagcgctgcctggcg
ctcagccacccgtatctctatgcccagctggacgcaccgcgctgcgcgcgcctggcgctg
cccgcggtctacgccttctgcaccctcttctgctccttgcccctgctgggcctgggccag
caccagcagtattgccccgggagctggtgcttcatccgcctgcgctctgcagacccgggg
ggccgcgccttctccctggcttatgccagcctcgtggccctgctggtggcagccatcatc
ctctgcaacggctcggtcactctaagcctctgccgcatgtaccgccagcagaggcgacac
caaggctcgctggtccctggcccccggaggggcgagggcgaggttgatcacctgattctg
ctggctctcatgacggtcatcatggctgtgtgctccctgcctctcacgatccgcggcttc
acacaggccatcacccctgacagcagcgagatgggggatctcctagccttccgtttcaac
gccttcaaccccatcctggacccctgggtcttcatccttttccgcaaggccgtcttccag
cgcctcaagctctggttctgctgttgcctctgccccggacctgcccgtggccactcgcaa
acacccctgagccggcctgcctcagggaggaaggacccaagggcccccgccactctcggg
ggaaaggaggggaactgggtgcctttgtcagcatggggggaggcgcagggggggtctgcg
gcacagcgagctggcagcagcaccgtgggaacgacgtccaaagcggggtccgcggcagcc
tgctccctctgctga

DBGET integrated database retrieval system