KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516081
Entry
107516081         CDS       T06036                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase isoform X1
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04152  AMPK signaling pathway
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107516081 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107516081 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516081 (EEF2K)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     107516081 (EEF2K)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   107516081 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1
Other DBs
NCBI-GeneID: 107516081
NCBI-ProteinID: XP_016010980
LinkDB
Position
Unknown
AA seq 724 aa
MADEDLIFRLEGVGGQTPRAGRDGASDTDSEDEDGYFICPITDEPRSHQLVSAKANARYG
DLMRGEQYGSSGSPAGSFSFKEAWKHAIEKAKHMPDPWAEFHLEDIATECATRHRYNAVT
GEWLEDEVFIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYVESVGRDVY
FEDVRLQMEAKLWGEEYNRHKPPKQVDIVQMCVVELRERLGRPLFHLEHYIEGKYIKYNS
NSGFVRDDNLRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEAGTDFGDGNLG
VRGMALFFYSHACNRICRSMGLTPFDLSPGEQDAVNQNAKLLQSAKTTLRGTEEKCGSPR
VRTLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDPLHWPMFADLDNL
GPRDHDHLDNHRDSENGGDSGYPSEKRGELDDPEPREHGHSNGSRRYESDEDSLGSCGRV
CVEKWNDLNPSRLHLPRPSAMALEMQRLGALGLEKRVGKSILGKVHLAMVRYHEAGRFCG
KDGAWDRASAMFHLQHAADLGELEAIVGLGLMCWQLPHLILPDISLQETEENQTRGFNYL
LRAAEAGDRQSMILVARAFDTGQNLSPDRSRDWPEALHWYSTALARTDYDEGGEYDGMQD
EPRHALLAREAAMLSTGGCGLQRDPRRAGDLYTQAAEAATEAMKGRLATQYYEKAEEAWA
QMEE
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcagacgaggacctcatcttccgcctggaaggcgttggtggccagaccccccgggcg
ggccgcgacggggcctccgacacagacagcgaggacgaggacgggtacttcatctgcccc
atcaccgacgagccccggtcacaccagctcgtcagtgccaaggcgaatgcccgctacgga
gacctgatgagaggagagcagtacggctccagcgggtcccccgccggctccttcagcttc
aaggaggcctggaagcatgcgatcgagaaggccaagcacatgcctgacccctgggccgag
ttccacctggaggacatcgccacggaatgcgccacgcgccacaggtacaacgcagtcacc
ggcgagtggctggaagatgaagtcttcatcaagatggcctctcagcccttcggccgcgga
gcaatgagggagtgcttcaggacgaagaagctctcgaacttcctgcacacgcagcagtgg
aaaggggcctccaactacgtggcgaagcgctacgtcgagtcggtgggcagagacgtgtac
ttcgaggacgtgcgcctgcagatggaggccaagctctggggagaggagtataatcgccac
aagccccccaagcaggtggacatcgtgcagatgtgcgtggtggagctgcgggagagactc
ggccggcccctgttccacctggagcactacatcgagggcaagtacatcaagtacaactcc
aactcgggcttcgtccgcgatgacaacctgcgcctgacgccgcaggccttcagccacttc
acgttcgagcgttccggccaccagctgatcgtggtggacatccagggtgtgggcgacctc
tacaccgacccgcagatccacacggaggcgggcaccgactttggggacggcaacctgggt
gtccgggggatggcgctgttcttctactcgcacgcctgcaaccgcatctgcaggagcatg
ggcctcacgccctttgacctgtcgccgggggagcaggacgcggtgaaccagaacgccaag
ctgctgcagtcggccaagaccaccttgagggggacagaggagaagtgtgggagcccccga
gtgcggaccctctcgggaagccggccgcccctgctcctccgcctgtcggagaactcgggg
gacgagaacatgagcgacgtgacctttgactctctcccctcctccccgtcctcggccacg
ccgcacagccagaagctggaccccctccactggcccatgtttgccgacctcgataacctg
ggtccccgagatcacgaccacctggacaaccaccgggactctgagaacggtggggacagc
ggataccccagtgagaagcggggcgagctggatgacccggagccccgagaacacggccac
tccaacggcagccggaggtacgagtcggacgaagacagcctgggcagctgcggacgggtc
tgcgtggagaagtggaatgacctcaacccctcccgcctccacctgccgaggccctcggcc
atggccttggagatgcaaaggcttggcgctctgggccttgagaagagagtcgggaagtcc
attctggggaaggtgcacctggccatggtgcgctaccacgaggcggggcgcttctgcggg
aaggacggggcctgggaccgcgcatctgccatgttccacctgcagcacgcggccgacctg
ggcgagctggaggccatcgtgggcctggggctcatgtgctggcagctgccgcatctcatc
ctgcccgacatctctctgcaggaaacggaggaaaatcaaaccagaggattcaactactta
ctgagggcggccgaagctggtgacagacagtccatgatcctagtggcgcgagctttcgac
accggccagaacctcagcccggacaggtcccgagactggccagaggctctgcactggtac
agcaccgccctggcgaggacggactacgacgagggcggcgagtacgacgggatgcaggac
gagccgcggcacgcgctgctggccagggaggccgcgatgctgtccaccggcggctgcggg
ctgcagagggacccgcggagggcaggagacttgtacacccaggcggccgaggcagcgaca
gaagccatgaagggccggctggccacccagtactacgagaaggcggaggaggcctgggca
cagatggaggagtga

DBGET integrated database retrieval system