KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516089
Entry
107516089         CDS       T06036                                 

Gene name
PLK1
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107516089 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107516089 (PLK1)
   04114 Oocyte meiosis
    107516089 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107516089 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516089 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107516089 (PLK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107516089 (PLK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107516089 (PLK1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107516089 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107516089 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    107516089 (PLK1)
SSDB
Motif
Pfam: Pkinase POLO_box PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107516089
NCBI-ProteinID: XP_016010995
LinkDB
Position
Unknown
AA seq 600 aa
MSAAATAGKLARAPGEPGKAGGPAAAAPGAPAAAPPAKEIPEVLVDPRSRRRYLRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPAARPTIHELL
NEEFFTSGYIPARLPITCLTVPPRFSLAPSSLDPSSRKPLSILNKGTENPVPERPREKEE
PAVRETSEAADCHLGDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGVSLQYVERDGTESYLTVNXLMKKITLLKYFRN
YMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIVLHLSNGCVQVNFFQDHTKLILC
PLMAAVTYINEKRDFRTYRLSLLEEHGCSRELASRLRYARTMVDKLLGSRSASTRLKASS
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgagtgccgcggccacagcagggaagctggcgcgggcgccaggtgagcccgggaaggcc
gggggccccgcagctgcagcgcccggggcgccggcggccgccccgccggcgaaggagatc
ccggaggtcctagtggacccgcgcagccggcggcgctacctgcggggccgcttcctgggc
aaggggggctttgccaagtgcttcgagatctcggacgcagacactaaggaggtgttcgcg
ggcaagatcgtgcccaagtcgctgctgctcaagccgcaccagaaggagaagatgtccatg
gagatctccattcaccgcagcctcgcacaccagcatgtcgtgggcttccacggctttttc
gaggacaacgacttcgtgttcgtggtgctggagctctgccggcggaggtcgctcctggag
ctgcacaagcgcaggaaagcgctcacggagcccgaggcccgctactacctgcggcagatc
gtcctgggctgccagtacctgcaccggaaccgcgtcatccaccgggacctgaagctgggc
aacctcttcctgaacgaggacctggaggtgaaaataggggatttcggactggcaaccaaa
gtcgaatatgacggggagcggaagaagaccctgtgcgggaccccgaattacatagcccct
gaggtgctgagcaagaaggggcacagcttcgaggtggacgtgtggtccatcgggtgcatc
atgtatactttgttagtgggcaaaccaccttttgagacgtcttgcctaaaagagacctac
ctccggatcaagaagaatgagtacagtattcctaagcacatcaaccccgtggccgcctcc
ctcatccagaagatgctccagacagaccccgccgcccgccccaccattcacgagctgctg
aacgaggagttcttcacttccggctacatccccgcccggctgcccatcacctgcctcacc
gtcccgcccaggttttccctcgcccccagcagcctggaccccagcagccggaagcctctc
tccatcctcaacaaaggcaccgagaaccccgtgcctgagcggccccgggagaaagaggag
ccagcggttcgggagaccagcgaggcggccgactgccacctcggcgacatgctgcagcag
ctccacagcgtcaacgcctccaagccctcggagcgggggctggtgaggcaagaggaggca
gaggaccccgcctgcatccccatcttctgggtcagcaagtgggtggactattcggacaag
tacggcctcgggtaccagctgtgtgacaacagcgtgggggtgctcttcaacgactccaca
cgcctcatcctctacaacgacggcgtcagcctgcagtacgtcgagcgcgacggcaccgag
tcctacctcaccgtgaacnccctgatgaagaagatcaccctcctcaagtatttccggaac
tacatgagcgagcacctgctgaaggcgggggccaacatcacgccgcgggagggcgacgag
ctggcgcggctgccgtacctgcgcacctggttccgcacgcgcagcgccatcgtcctgcac
ctgagcaacggctgcgtgcaggtcaacttcttccaggaccacaccaagctcatcctgtgc
cccctgatggccgccgtgacctacatcaacgagaagcgggacttccgcacgtaccgcctg
agcctgctggaggagcacggctgctcccgggagctggccagccggctgcgctacgcccgc
accatggtggacaagctgctgggctcgcgctcggcctccacccgcctcaaggcctcctcg
tag

DBGET integrated database retrieval system